Loading...
012725 PC Meeting AgendaPLANNING COMMISSION MEETING RICHFIELD MUNICIPAL CENTER, COUNCIL CHAMBERS JANUARY 27, 2025 7:00 PM Call to Order Approval of the Minutes Approval of the minutes of the Regular Planning Commission meeting of December 9, 2024. Open Forum: Opportunity for the public to address the Commission on items not on the Agenda. Agenda Approval 1. Approval of the Agenda Public Hearings 2. Public Hearing to consider a request for two variances from the setback requirements for a detached garage at 6612 5th Avenue South. Staff Report No. 1 3. Public hearing to consider a request for site plan approval of an entirely new Wood Lake Nature Center building at 6710 Lake Shore Drive. Staff Report No. 2 Liaison Reports Community Services Advisory Commission City Council Housing and Redevelopment Authority (HRA) Richfield School Board Transportation Commission Chamber of Commerce Sustainability Commission City Planner's Reports 4. City Planner's Report The first reading for text amendment to allow dynamic drive thru signs was on January 14th. The second reading will be on January 28th. Upcoming work sessions: February 24th February meeting discussion 5. Next Meeting Time and Location Planning Commission Work Session Monday, February 24, 2025 at 5:45 in the Bartholomew Room. Regular meeting Monday, February 24, 2025 at 7:00 in Council Chambers. 6. Adjournment Auxiliary aids for individuals with disabilities are available upon request. Requests must be made at least 96 hours in advance to the City Clerk at 612-861-9739. *Complete information on how to share comments or questions with the Planning Commission, see our Agendas and Minutes page https://www.richfieldmn.gov/city_government/planning_commission/agendas_and_minutes.php CALL TO ORDER The meeting was called to order by Chair Holmvig-Johnson at 7:00 p.m. in the Council Chambers. M/Stursa, S/Kennealy, to approve the minutes of the Regular Planning Commission meeting of November 25, 2024. Motion carried: 6-0. OPEN FORUM No members of the public spoke. ITEM #1 APPROVAL OF THE AGENDA M/Stursa, S/Kennealy, to approve the agenda. Motion carried: 6-0. PLANNING COMMISSION MEETING MINUTES Richfield, Minnesota Regular Planning Commission Meeting December 9, 2024 Planning Commissioners Present: Eddie Holmvig-Johnson, Brett Stursa, Benjamin Surma, Matt Taraldsen, Stephanie Kowalkowski, and Brendan Kennealy Commissioners Excused: Cole Hooey Staff Present: Sam Crosby, Planner II and Ruby Villa, Planner I Others Present: Andrew Davies, Border Foods and Shannon King, Lawrence Signs APPROVAL OF MINUTES ITEM #2 PUBLIC HEARING TO CONSIDER A REQUEST FOR A ZONING CODE TEXT AMENDMENT REGARDING DRIVE-THROUGH SIGNS. Planner Villa presented Staff Report No. 19. Chair Holmvig-Johnson opened the public hearing. Andrew Davies and Shannon King, representatives for Border Foods (the Applicant), gave a brief report regarding the request. M/Kennealy, S/Surma, to close the public hearing. Motion carried: 6-0. Commissioner Taraldsen commented that the proposal seemed reasonable. Commissioner Stursa requested clarity regarding quantity allowances for drive-through signs. Planner Villa clarified that the proposed ordinance would allow two drive-through signs per drive-up lane. Commissioner Stursa asked staff to confirm that a Conditional Use Permit would still be required for a drive-through. Planner Crosby clarified that while a drive-through use requires, and will continue to require, a Conditional Use Permit, a drive-through sign itself would not require one –changes in signage typically only require a sign permit. Commissioner Stursa asked staff why the table within the historical context section of the staff report did not contain information for all drive-through signs in the city. Planner Villa stated that the table included only information found within approved sign permits on file. Planner Villa provided additional information regarding existing drive-through signs and their proximity to residential properties. Signs that do not meet the separation requirement between dynamic displays and residential properties cannot convert to dynamic unless a variance is granted. In response to Chair Holmvig-Johnson, Planner Villa clarified that existing brightness standards in the code require dynamic displays to have ambient lighting capabilities. Planner Villa also mentioned that staff have identified the brightness standards of the sign code as something to take a closer look at in the future. M/Surma, S/Taraldsen, to recommend approval of an ordinance amendment regarding drive-through signs. Motion carried: 6-0. LIAISION REPORTS Community Services Commission: Commissioner Kowalkowski had no report. City Council: Chair Holmvig-Johnson stated that the City Council has had a few work sessions and a joint session with the School Board. At the most recent meeting, they performed routine approvals of election results and considered a proposal to not count write-in votes unless a candidate has requested that they be counted. The Council also is beginning to assess the sales tax that was recently approved by voters. Housing and Redevelopment Authority (HRA): Commissioner Stursa had no report. Richfield School Board: Commissioner Kennealy had no report. Transportation Commission: Commissioner Surma had no report. Chamber of Commerce: Commissioner Hooey was absent. Sustainability Commission: Commissioner Taraldsen reported that the city is planning on putting solar power infrastructure on top of the new public arena – which will save the city about $72,000. ITEM #3 CITY PLANNER’S REPORT Planner Crosby had no report. ITEM #4 NEXT MEETING TIME AND LOCATION The next regular meeting is on Monday, January 27, 2025, at 7:00 pm in the Council Chambers. ITEM #5 ADJOURNMENT M/Kennealy, S/Surma, to adjourn the meeting. Motion carried: 6-0 and the meeting was adjourned at 7:17 p.m. Submitted by: Ruby Villa Brett Stursa Planner I Planning Commission Secretary AGENDA SECTION:Public Hearings AGENDA ITEM # CASE NO.:Staff Report No. 1 PLANNING COMMISSION MEETING 1/27/2025 REPORT PREPARED BY: Sam Crosby, Planner II DIRECTOR REVIEW: Melissa Poehlman, Community Development Director 1/16/2025 ITEM FOR COMMISSION CONSIDERATION: Public Hearing to consider a request for two variances from the setback requirements for a detached garage at 6612 5th Avenue South. EXECUTIVE SUMMARY: Anita Perkins (Applicant), on behalf of her and her husband, Cerren Perkins, is requesting deviation from the setback requirements in order to construct a new detached garage of the exact same size, and in the exact same location, as the previous garage. The “R” (Low Density Residential) district requires a two foot setback from the rear/alley lot line and a three foot setback from the neighbor/north side lot line. The previous garage was only 1.8 feet from the rear/alley (about a 2 inch difference), and 2.4 feet from the north side (an approximately 7 inch difference). The reason the Applicant is requesting the same setbacks that the previous garage had is because the previous footing is still in place and is in good, useable condition. Staff finds this to be a physical condition unique to the site that justifies deviation from the Zoning Code. Due to the presence of the reuseable footing, staff believes that the requested variances are reasonable and will not adversely impact the health or aesthetics of the community. Therefore, staff recommends approval of both variances, subject to the conditions listed in the draft resolution of approval. RECOMMENDED ACTION: Conduct and close a public hearing and by motion: Approve two setback variances for 6612 5th Avenue South. BASIS OF RECOMMENDATION: A.HISTORICAL CONTEXT The previous garage structure was constructed in 1964. The original permit is on file in the City’s archives, and it denotes the size as "16 x 22." From the 1962 version of the City’s Zoning Code, it appears that a five foot setback from the side property line may have been required for detached accessory buildings, so it is unclear regarding the conformity of the previous garage location. The previous garage was damaged and demolished sometime between 2009 and 2012. (A demolition permit was not on file.) One of the building inspectors recently inspected the slab in person and it is in useable condition. B.POLICIES (resolutions, ordinances, regulations, statutes, etc): 2 Zoning Code Section 509.25 addresses nonconformities. It states that nonconformities may be continued, include through repair, replacement, restoration, maintenance, or improvement, but not including expansion unless the nonconformity has been discontinued for a period of more than 1 year. Because the garage has been demolished for at least 13 years now, variances are needed to replace the garage in the same location. There is one other accessory structure on the property – a 56 square foot shed. The two structures together will total 411 square feet; well within the 783 square foot limit. The Applicant has calculated the impervious area and will be within the 45% limitation. Per the Building Code, the closer a garage gets to a property line, the more fire-proof the building must be. The Applicant is aware of the structural Code requirements associated with reduced setbacks and will be complying with them. C.CRITICAL TIMING ISSUES: The statutory 60-day clock started when a complete application was received on December 26, 2024. Therefore, the 60-day clock ends on February 14, 2025. A decision is required by this date, or the City must notify the Applicant that it is extending the deadline (up to a maximum of 60 additional days or 120 days total) for issuing a decision. D.FINANCIAL IMPACT: None - The required application fees have been paid. E.LEGAL CONSIDERATION: Notice of the public hearing was published in the Sun Current newspaper on Thursday, January 16th, and was mailed to properties within 350 feet of the subject site. ALTERNATIVE RECOMMENDATION(S): Approve the variances with additional and/or modified stipulations. Deny the variances with a finding that the proposal does not meet City requirements. PRINCIPAL PARTIES EXPECTED AT MEETING: Anita Perkins, Applicant ATTACHMENTS: Description Type Draft Resolution of Approval Resolution Letter Required Findings Statement Backup Material Applicant's Request Narrative Backup Material Property Survey Backup Material Construction Details Backup Material Location and Zoning Map Backup Material RESOLUTION NO. 254 RESOLUTION OF THE RICHFIELD PLANNING COMMISSION GRANTING APPROVAL OF TWO GARAGE SETBACK VARIANCES AT 6612 5th AVENUE SOUTH WHEREAS, an application has been filed by Anita and Cerren Perkins, with the City of Richfield which requests approval of two setback variances: a 0.2 foot variance from the 2 foot rear yard setback, and a 0.6 foot variance from the 3 foot side yard setback, in order to construct a detached garage 1.8 feet from the rear property line and 2.4 feet from the north side property line, at 6612 5th Avenue South, property legally described as: LOT 4, BLOCK 2, McCUTCHAN’S PORTLAND AVENUE PARK, HENNEPIN COUNTY, MINNESOTA; WHEREAS, Zoning Code Section 514.13 Subd.4.a,establishes the interior side setback requirement for accessory buildings located entirely five feet or more beyond the rear building line of the principal building as three feet; and WHEREAS, Zoning Code Section 514.13 Subd.4.a, establishes that, for lots which have alley access and there is no utility easement, a detached garage may be two feet from the rear lot line; and WHEREAS, the variances are for the purposes of replacing a previously removed detached garage with a new detached garage of the same size and in the same location; and WHEREAS, Minnesota Statutes Section 462.357, Subdivision 6, provides for the granting of variances to the literal provisions of the zoning regulations in instances where enforcement would cause “practical difficulty” to the owners of the property under consideration; and WHEREAS, the property is unique in that there remains an existing foundation which is in useable condition; and WHEREAS, the Planning Commission of the City of Richfield held a public hearing for the requested variances at its January 27, 2025 meeting; and WHEREAS, the variances meet the requirements of Zoning Code Section 547.11, Subdivision 1, as detailed in the “required findings” statement ; and WHEREAS, notice of the public hearing was published in the Sun Current newspaper and mailed to properties within 350 feet of the subject property; NOW, THEREFORE, BE IT RESOLVED, by the Planning Commission of the City of Richfield, Minnesota, as follows: Based upon the above findings, variances are hereby approved subject to the following stipulations: a.The applicant shall record this Resolution with the County, pursuant to Minnesota Statutes Section 462.36, Subd. 1 and the City’s Zoning Ordinance Section 547.11, Subd. 7, prior to the issuance of a building permit. b.This approval shall expire one year from the date of approval unless the use has commenced. Adopted by the Planning Commission of the City of Richfield, Minnesota this 27th day of January 2025. _____ Eddie Holmvig-Johnson, Planning Commission Chair ATTEST: Brett Stursa, Planning Commission Secretary Required Findings Perkins Garage Setback Variances / 6612 5th Avenue South Variance: (Subsection 547.11) In evaluating a variance, the Planning Commission shall consider the following: a)There are unusual or unique circumstances that apply to the property which were not created by the applicant and do not apply generally to other properties in the same zone or vicinity. The previous garage footing, which is still in place and is still in useable condition, is a unique circumstance that does not generally apply to other properties in the same zone or vicinity. b)There are “practical difficulties” that prevent the property owner from using the property in a reasonable manner. Because the existing footing is in good, useable condition, it reasonable to reuse it. If the footing were cracked or damaged to the point of significant repair or replacement, the footing could be altered during repair or replacement to comply with code. However, staff would classify tearing out and repouring the footing, when not otherwise needed, as a practical difficulty. c)The variance would not alter the character of the neighborhood or the locality. Being that there used to be a garage of the exact same size in the exact same location for at least 45 years, the proposed variances are unlikely to alter the character of the neighborhood. d)The variance is the minimum necessary to alleviate the practical difficulty. If the existing footing is to be reused, these variances are the minimum necessary. The proposal meets all other regulations, including height, impervious area, and building to lot coverage. e)The variance is in harmony with the general purpose and intent of the ordinance and consistent with the Comprehensive Plan. In relation to the zoning ordinance, the purpose of setbacks is to provide a buffer from property lines, space to accommodate maintenance and repair, and to ensure adequate light, ventilation, and privacy for neighboring properties. In relation to the rear yard setback, the property owner is welcome to stand in the public right-of-way for maintenance and repair. In relation to the side yard setback, two feet is typically considered enough space to stand in for maintenance purposes for a single-story structure. The requested variances are not anticipated to adversely impact the aesthetics of the community or its health, safety and welfare, the preservation of which are the principal objectives of the zoning code. In relation to the Comprehensive Plan, setbacks are not specifically mentioned. The Plan does include a goal to “support ongoing maintenance and upkeep of residential properties“. [ G r a b y o u SOUTHEAST WESTNORTH D t � • : 1t 1.'2024 � J:54 P:\t ·-'''!' : J D i5S:.:;4"2f-l7 E • , , · HJ: :ti,iS es uy TM JE>'i ·mH, d Prh:e: S� 778.86 ,g '11 GARAGE l-'1i. ,pfuJ Hints for Garage ConstructionFo • "1 ,•, ,'l,.� :,•·mate 1 () i·1ch .son i;enter with single trc3tcd bottom plate and double top pl a, .. P a" J '2 L 11-:.1 '1ui1Jmg•. :;tuds should be cut for an approximate 10-or 12-foot plate height. , , t U 1 • <il r l 10-·:1:a,•J, .he st,·r;] k:1 g h s}1ui.cl: e vcrif ed ba�ed off the Chl:.l frar n1:-Pae he ght :--1 ,,t length}. tn1<, h ·el ,md other framing should be confinned. Steel is estimated to the inch, make sure the lengths are ,� .ik hi., :i.! 011 it al overall building design. 1 • ,. ,� mc i l:ded __ re �s mat .. , at 2 feet on center spacing. The design is based on the zip code pwdded, design and •f• -� .lim.i<l ·: 0 • \. : ,ir 1 �P � fied \I ;th the e.\ccp1ion d'tr immir.g the lTL!SS tails t<J :he'-' .TL'c·t O'.'c:·h,Hl:-. •·�c•. , •• ..: g .. :,. 11., .,t,pi-1ort s ail(iard ceiling and insulation mmerials . . •� c. �rJ ., ,1:. ...s .. 1 ••. s.. .11. t ;ith 18 inch and 24 . 1eJ-. gable overhang�. 16'-0 Page 8 of 11 """""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" """"""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""""" VETS MEMORIAL HEREDIA 66TH ST E 66TH S T E 66TH ST EPORTLANDAVE PORTLAND AVEPORTLANDAVE6 6 T H S T E 67TH ST E5TH AVE SAPPLE LN4TH AVE S6 6 T H S T E PORTLAND AVE± Location and Zoning Map 0 160 32080ft I:\GIS\Community Development\Case Maps\2025\Perkins Var - 6612 5th Ave S.mxd 6612 5th Avenue South Perkins Garage Variances SUBJECTSITE Legend Parks R Low Density Residentiall """"""""""""Veteran's Park Area Overlay MR-2 Multi-Family MR-3 High-Density Multi-Family C-2 General Commercial MU-N Mixed Use-Neighborhood R-1 Single Family Residential City Hall AGENDA SECTION: Public Hearings AGENDA ITEM # CASE NO.:Staff Report No. 2 PLANNING COMMISSION MEETING 1/27/2025 REPORT PREPARED BY: Ruby Villa, Planner I DIRECTOR RE VIEW: Melissa Poehlman, Community Development Director 1/23/2025 ITEM FOR COMMISSION CONSIDERATION: Public hearing to consider a request for site plan approval of an entirely new Wood Lake Nature Center building at 6710 Lake Shore Drive. EXECUTIVE SUMMARY: HGA (Applicant), on behalf of the Richfield Recreation Services Department, has submitted an application for site plan approval to construct a new Wood Lake Nature Center building at 6710 Lake Shore Drive. As most parks in the City, the property is zoned R Low Density Residential. Governmental buildings are a permitted use in this district; site plan review is required due to the construction of a new building. The proposed site plan is designed to provide a new one-story building that will be more than twice the size of the existing facility. The new building will be 40 feet farther from the lake and 80 feet closer to the street. It will be characterized by dark brown wood siding and green roof forms. The interior will include an improved lobby, exhibits, lounge and conference spaces, multipurpose rooms for educational programming and rentals, and staff office space. The parking lot will be improved through the addition of landscaping, perimeter plantings, and Electric Vehicle (EV) chargers, but it will remain mostly unchanged. Construction is set to begin in the Spring of this year, with completion in the Spring/Summer of 2026. See the Applicant’s narrative for more information. No variances are requested as part of the project but there are certain modifications necessary in regard to landscaping requirements. As discussed in the "Policies" section below, staff finds these modifications reasonable based on the unique nature of the property and the project’s sustainability and energy reduction features. Staff recommends approval of the project, subject to the conditions listed in the draft resolution of approval. RECOMMENDED ACTION: Conduct and close a public hearing and by motion: Recommend approval of the proposed site plan for a new Wood Lake Nature Center building at 6710 Lake Shore Drive. BASIS OF RECOMMENDATION: A.HISTORICAL CONTEXT The existing facility was built and opened its doors in 1971. It was one of the first nature centers built in the Twin Cities. Conversations regarding construction of a new facility began in 2021, followed by pre- design planning. 3 Following an Request For Proposal (RFP) process in 2023, HGA was chosen to provide architectural and engineering services for the design and construction administration of the new facility. Three open houses, a survey, and four engagement sessions were held in 2024 as part of public engagement initiatives. The public input received as part of these initiatives was used to help develop an initial design of the new facility. B.POLICIES (resolutions, ordinances, regulations, statutes, etc): Application materials were shared with the Minnesota Department of Natural Resources. No significant comments were received. Zoning Code Section 547.13 establishes various criteria and standards for site plan review. The proposed site plan meets or exceeds these requirements. The attached findings of fact provide further support for staff’s recommendation for approval. Zoning Code Section 514 establishes R District requirements for nonresidential buildings. The project meets setback and height requirements, as well as lot coverage and impervious surface. Zoning Code Section 544 establishes general building and performance standards, which include landscaping requirements, parking requirements, screening requirements, and architectural standards. A majority of landscaping and screening requirements are met, with the exception of the following: Due to the unique nature of the use, the Applicant is requesting a modification regarding the requirement for irrigation (below). In instances in which an Applicant is unable to meet the requirements of Section 544.03, Subd. 4 – 7, the City may review and decide the adequacy of each landscaping and screening design based on whether or not it meets the intent of this ordinance. Irrigation: “All landscaped areas within new developments or developments with additions of 100 percent of gross floor area or more shall be irrigated by an underground mechanical irrigation system. All other sites are highly encouraged to install irrigation systems.” (Section 544.01, Subd. 4.h). The use of drought tolerant native plantings eliminates the need for long-term irrigation. Hose bibs will also be located at consistent intervals around the building to maintain plantings in drought conditions. It is staffs’ opinion that, for these reasons and others stated in the applicant’s narrative, the intent of this requirement - to keep plants alive – will be met and irrigation should not be required. · Landscaping Quantities (Section 544.03, Subd. 6) · Landscaping for commercial and mixed-use sites is required at the rate of one tree per 2,500 square feet of Developable Landscaping Area and one shrub per 1,000 square feet of Developable Landscaping Area (defined as the total area of a development site or phase minus the portion of that area within a natural water body or a protected wetland). For this 64.5-acre site that would mean more than 1,000 trees and almost 3,000 shrubs. As a nature center, and the largest and most ecologically varied property in the City – with a diversity of natural biomes which include marsh, wetland, prairie, and woodland with hundreds of existing trees – some flexibility in regard to this requirement is warranted. Per Section 544.03, Subd.4.i, in instances where healthy plant materials exist on a lot prior to development, the application of landscaping standards may be adjusted by the City to allow credit for such material, provided that such adjustment is consistent with the intent of the Code. Staff finds this to be a prime example of such. o Of 718 existing trees (which were surveyed in 2024) within the northernmost 11- acres of the property, about 75 will be removed to accommodate the new building and 13 will be transplanted elsewhere on site. Fourteen new trees will also be planted. · Screening (Section 544.05) Refuse collection, recycling and utilitarian elements are required to be designed into the interior space of buildings. While not technically inside the building, the fully enclosed area connected to the rear east portion of the building will be covered by a wide eave overhang and will be enclosed with exterior materials that match all other elements of the building. Additionally, there will be an interior door in order for staff to access refuse containers from the inside of the building. Staff finds that the intent of the requirement for internal refuse collection is met. C.CRITICAL TIMING ISSUES: 60-DAY RULE: The 60-day clock started when a complete application was received on January 7, 2025. Therefore, the 60-day clock ends on March 8, 2025. A decision is required by this date, or the City must notify the Applicant that it is extending the deadline (up to a maximum of 60 additional days or 120 days total) for issuing a decision. D.FINANCIAL IMPACT: None; required application fees have been paid. E.LEGAL CONSIDERATION: Notice of the public hearing was published in the Sun Current newspaper on January 16, 2025, and was mailed to properties within 350 feet of the subject site. Council consideration of this application has been tentatively scheduled for February 11, 2025. ALTERNATIVE RECOMMENDATION(S): Recommend approval of the request with additional and/or modified stipulations. Recommend denial of the request with a finding that the proposal does not meet City requirements. PRINCIPAL PARTIES EXPECTED AT MEETING: Karl Huemiller, Recreation Services Director and Andrew Holmgren, HGA ATTACHMENTS: Description Type Draft Site Plan Resolution Resolution Letter Location and Zoning Map Backup Material Required Findings Backup Material Applicant's Narrative Backup Material Site Plans Backup Material Exterior Renderings Backup Material Exterior Elevations Backup Material Floor Plan Backup Material Landscape Plan Set Backup Material Photometric Plan Backup Material RESOLUTION NO. RESOLUTION APPROVING A SITE PLAN AT 6710 – LAKE SHORE DRIVE WHEREAS, an application has been filed with the City of Richfield which requests site plan approval to construct a new Wood Lake Nature Center facility at 6710 Lake Shore Drive, land legally described in Exhibit A, attached; and WHEREAS, the Planning Commission of the City of Richfield held a public hearing and recommended approval of the requested Site Plan at its January 27, 2025 meeting; and WHEREAS, notice of the public hearing was mailed to properties within 350 feet of the subject property, and published in the Sun-Current on January 16, 2025; and WHEREAS, the request meets those requirements necessary for approving a Site Plan as specified in Richfield’s Zoning Code, Section 547.13, Subd. 8 and as detailed in City Council Staff Report No.___; and WHEREAS, the City has fully considered the request for approval of a site plan; and NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Richfield, Minnesota, as follows: 1.The City Council adopts as its Findings of Fact the WHEREAS clauses set forth above, and the findings listed in the Required Findings Statement. 2.A site plan is approved for a new Wood Lake Nature Center facility of 17,000 square feet of gross floor area as described in City Council Report No. ___, on the Subject Property legally described as attached. 3.The approved site plan is subject to the following conditions: a)Prior to issuance of construction permits, plans shall be revised to comply with outstanding items related to bicycle parking and landscaping, as detailed in the City’s Administrative Review Committee Report dated January 3, 2025. b)The applicant is responsible for obtaining all required permits, and compliance with all other City, County and State regulations, including the MN Department of Natural Resources. c)Bike racks shall be installed according to manufacturer specifications. d)This does not constitute approval of any signage; sign permits are required and must be applied for separately. e)Prior to the issuance of an occupancy permit the applicant must submit a surety equal to 125% of the value of any required improvements or conditions of approval that are not yet complete. f)The property owner is responsible for the ongoing maintenance and tending of all exterior improvements in accordance with approved plans. 4.This approval shall expire one year from issuance unless the use for which the permit was granted has commenced, substantial work has been completed or upon written request by the applicant, the Council extends the expiration date for an additional period, as required by the Zoning Ordinance, Section 547.13, Subd. 9. Adopted by the City Council of the City of Richfield, Minnesota this 11th day of February, 2025. Mary B. Supple, Mayor ATTEST: Michelle Friedrich, City Clerk Exhibit A JAMES AVE SIRVINGAVESHUMBOLDT AVE SGIRARD AVE SEMERSON AVE S65TH ST W LYNDALEAVES72ND ST W 70TH ST W PLEASANT AVE68TH ST W PILLSBURY AVE73RD ST W 68TH ST W 71 ST S T W 72 ND ST W HARRIET AVEDUPONTAVES66 TH ST W OAKGROVEBLVD67TH ST W BRYANTAVES71ST ST W RAEDR GARFIELDAVE70 TH ST W 73 RD ST W WENTWORTH AVEHUMBOLDT AVE SLAKESHOREDRSPILLSBURY AVE69TH ST W 67TH ST W EMERSONAVESGARFIELD AVEGRAND AVE SWENTWORTH AVEGIRARD AVE SHUMBOLDTAVESINTERSTATE35WLAKESHOREDRS GRAND AVE SPLEASANT AVEJAMES AVE SINTERSTATE 35W± Location and Zoning Map 0 740 1,480370ft I:\GIS \Comm unity D evelopm ent\Case M aps\2025\WLNC Site Plan Approval - 6710 Lake Shore Dr.mxd 6710 Lake Sho re Drive Case #:Z24-19 SU BJEC TSITE Legend R Low Density Residential R-1 Single Family Residential PMR Planned Multi-Family MR-2 Multi-Family MR-3 High-Density Multi-Family C-1 Community Commercial C-2 General Commercial PC-2 Planned General Commercial PMU Planned Mixed Use Wood Lake Park Required Findings Wood Lake Nature Center / 6710 Lake Shore Dr Site Plan Approval (Subsection 547.13) In evaluating a site plan, the Planning Commission and Council shall consider its compliance with the following: a) Consistency with the various elements and objectives of the City’s long range plans including, but not limited to, the Comprehensive Plan. The City’s Comprehensive Plan designates this property as a Park. The Wood Lake Nature Center building itself is considered a “Community Facility”. The 2018 Parks Master Plan specifically memorialized that one of the community’s top park priorities identified during community engagement was the need for “a remodeled nature center to accommodate expanding programs.” Some of the recommendations provided in the plan for renovation or replacement of the facility included: more meeting space, more room for entertainment, a catering kitchen, laundry facility, ADA accessibility, classrooms, and expanded storage. Almost all of the recommendations are addressed by the proposed project. Further, the project also advances the following Parks System Comprehensive Plan objectives:  Preserve crucial public places like parks, recreation areas, open spaces, wetlands, and Wood Lake Nature Center.  Include criterion for all new park and facility improvements that improves sustainability of materials, energy use, operating cost and lifecycle replacement, and natural environmental impact.  Incorporate best practices for stormwater retention in new park development and in the renovation of existing parks.  Encourage parks to be naturalized with prairie grasses and pollinator-friendly plants, where suitable, to minimize maintenance costs and to beautify parks.  Provide all residents with access and the opportunity to be involved in recreation programs, regardless of age, culture and mobility level throughout the City.  Provide adequate seating, shade, trail lighting and a trail loops of varying lengths in parks to encourage active living for an aging population.  Provide parks and recreation facilities that are handicap accessible consistent with the Americans with Disabilities Act Accessibility Guidelines for Building and Facilities and universal design principles. b) Consistency with the purposes of the Zoning Code. The project is consistent with the R District regulations for nonresidential sites. All general building and performance standards will be specifically met or, as outlined in the policies section of the staff report, have been identified for Director modification and meet the intent of the ordinance. c) Preservation of the site in its natural state, insofar as practicable, by minimizing tree and soil removal, and designing any grade changes so as to be in keeping with the general appearance of neighboring developed or developing areas. While the building will be getting larger and closer to the street, which necessitates the removal of 75 existing trees; 13 trees (within the disturbed area) will be transplanted elsewhere on site, 14 new trees will be planted, and no significant changes in grade are proposed. d) Creation of a harmonious relationship of buildings and open spaces with the terrain and with existing and future buildings having a visual relationship to the proposed development. The proposed site layout is harmonious with the lake and the general terrain of the park. As mentioned in the staff report, the new building will be 40 feet further from the lake and 80 feet closer to the street. This helps to protect the shoreline of the lake while facilitating an improved pedestrian and user experience as soon as users enter the site. The parking lot will be “split” to accommodate a promenade-like entrance to the building with wide pedestrian walkways and landscaping. e) Creation of a functional and harmonious design for structures and site features including: i. Creation of an internal sense of order for the various functions and buildings on the site and provision of a desirable environment for occupants, visitors and the general community; The site layout is logical. The proposed pedestrian improvements and well-defined connection between the building and the street provide a generally desirable environment. ii. Appropriateness of the amount and arrangement of open space and landscaping to the design and function of the development; There is good design and function of open space, with various gathering spaces such as an amphitheater, lakeside deck, and children’s play area. Landscaping considers the context of the area and will include native drought-resistant plantings. Trees will be added to the landscape islands within the parking lot and will enhance pedestrian experience by providing shade. Perimeter plantings will also help to screen the parking lot from the street. Overall, while an appropriate amount of landscaping will be added, the terrain and natural biomes of the park help anchor the project with existing and lush surroundings. iii. Appropriateness of the materials, textures, colors and details of construction as an expression of the design concept of the project and the compatibility of the same with the adjacent and neighboring structures and functions; As a sustainably designed and highly energy efficient building, the details of construction are sensitive to and compatible with the area. Surrounded by forest, the building considers the context by remaining at one story and utilizing high quality exterior materials, in wood hues and natural tones. iv. Adequacy of vehicular, cycling and pedestrian circulation, including walkways, interior drives and parking, in terms of location and number of access points to the public streets, width of interior drives and access points, general interior circulation, separation of pedestrian, cycling and vehicular traffic and arrangement and amount of parking so as to be safe, convenient and, insofar as practicable, compatible with the design of proposed buildings, structures and neighboring properties. There will be adequate bike parking provided; twenty-three racks (46 spaces) at multiple entrances to the building. The pedestrian areas are also adequate with ADA access to both the west and east sides of the building. The arrangement of parking is safe, convenient and compatible with the building and surrounding park. The amount of parking is adequate. f) Creation of an energy-conserving design through design location, orientation and elevation of structures, the use and location of glass in structures, and the use of landscape materials and site grading. The development will meet Minnesota SB2030 energy reduction targets through the use of high performing building envelope systems, a traditional geothermal system, and a roof mounted solar photovoltaic array. g) Protection of adjacent and neighboring properties through reasonable provisions for such matters as surface water drainage, sound and sight buffers, preservation of views, light and air, and those aspects of design, not adequately covered by other regulations, which may have substantial effects on neighboring land uses. Adjacent properties are buffered from all the above by a significant amount of heavily forested land. WOOD LAKE NATURE CENTER Wood Lake Park is a 150-acre natural area dedicated to environmental education, wildlife observation, and outdoor recreation. The park features several wildlife viewing areas, an amphitheater, a picnic ground, and three miles of trail and boardwalks. The City of Richfield is working to replace its current outdated Nature Center building with a new facility. The project’s adjacency to wetlands and other ecological features means the building and site design are mindfully cautious in order to support, protect, and bolster native flora, fauna, and habitats while providing additional educational offerings and community space. The new site design modifies the existing parking lot to create a more visible and direct approach to the site and building entry which prioritizes pedestrian and bicycle circulation over passenger vehicles. By splitting the existing parking lot, the natural landscaping extends out to Lake Shore Drive, starting the immersive natural experience for visitors upon entering the site. Once on site, circulation includes a 12-foot-wide sidewalk that leads visitors from the street to the entry, additional paved paths on the street side of the building, and an ADA accessible path that circumnavigates the building providing easy access to the building and site amenities. The site design also includes a dry creek bed stormwater feature, a nature-based outdoor play space, a new 100-seat amphitheater, a lakeside deck, and natural plantings throughout. The new parking lot layout maximizes the number of spaces allowed under the zoning code (102 stalls) without expanding the footprint of the parking lot, even with the increase in building size. The existing parking lot (109 stalls), which was implemented prior to the current zoning requirements, was oversized based on the existing Nature Center’s square footage. With the new design more than seven stalls were eliminated with the split in the parking lot at the entry sequence to the building, but eight stalls were added to the vegetated island in the SE section of the parking lot to bring the total up to the maximum number of 102 stalls. Even with the added stalls the parking lot meets the requirement for 5% interior planting area and the redesign of the parking also reduced the impervious surface on site by 3,500 square feet. The parking stalls provided reflect both the code requirements and an appropriate number of spaces for daily use of the Nature Center including programming and events, as observed by staff. Considered in the parking lot design is the agreement with the Post Office for the contracted use of 14 stalls. The stalls are used for overnight parking and vacated during operating hours for the Nature Center and during scheduled large special events. The agreement with the Post Office is a source of revenue generation for the Nature Center. To better merge with its natural settings, the building is configured into small wings centered around a main entry and public exhibit space. With pockets of landscape captured by the building footprint, the outdoors extends inward to merge the indoor and outdoor environments. Expanding from its existing footprint of 6,225 SF to approximately 17,000S SF, the programming of the new building includes an improved lobby and entry experience, exhibits, lounge and conference spaces, multipurpose rooms for educational programming and rentals, staff office space, expanded restroom facilities, and rentals. The exterior material palette further suggests merging of the building with its natural surroundings by use of thermally modified wood for exterior cladding and prominent green roof forms above the large gathering spaces. The project will meet the rigorous Minnesota B3 guidelines and SB2030 energy reduction targets. Some of the features that will help achieve these goals are onsite stormwater management, native plantings, bird- friendly glazing, healthy material selection, high performing building envelope systems, a traditional geothermal system, and a roof mounted solar photovoltaic array. With the natural setting and the resilient low-maintenance goals of the Nature Center, underground mechanical irrigation is not planned for the project. As part of the Minnesota B3 guidelines, which must be met to comply with requirements connected to state funding the City has received, “No potable water shall be used for irrigation after a 5-year plant establishment period except for periods when actual rainfall for the month is less than 30% of the average rainfall for that month”. This means a permanent irrigation system is allowed by B3 but can only be used after the five-year establishment period if rainfall conditions are low. The use of native plantings which are drought tolerant after establishment eliminates the need for long-term irrigation. Hose bibs are located at consistent intervals around the building to maintain plantings in extreme drought conditions. Additionally, the building is located within a natural area without irrigation. Irrigating the building alone would negatively impact the natural feel of the park and the integration of the building into the landscape. Construction is set to being in the spring of 2025, completing in the spring/summer of 2026. T90 . 5 4 '50' WETLAND SETBACK50'WOOD LAKEOHWL=820.7NOTES:1.SEE SHEET C001 FOR CIVIL NOTES AND LEGEND.ZONING INFORMATIONEXISTING ZONING: R - LOW-DENSITY RESIDENTIAL (PARKS)PROPOSED ZONING:R - LOW-DENSITY RESIDENTIAL (PARKS)ADJACENT ZONING:R-1 - SINGLE FAMILY RESIDENTIALPMR - PLANNED MULTI FAMILYPC-2 - PLANNED GENERAL COMMERCIALSETBACK SUMMARY: BUILDING:40' FRONT SETBACK30' SIDE/REAR SETBACKPARKING:20' SETBACK FROM PUBLIC RIGHT-OF-WAYSITE INFORMATION AREA (SF) AREA (AC) TOTAL SITE AREA 2,812,181 64.56DISTURBED AREA 143,355 3.29EXISTING IMPERVIOUS 117,433 2.70PROPOSED IMPERVIOUS 128,506 2.95PROPOSED IMPERVIOUS SITE COVERAGE 56%(INCLUDES OFFSITE AREAS)SCALE IN FEET04080PARKING INFORMATIONMAXIMUM PARKING REQUIREMENTS:BUILDING: 3.33 STALLS PER 1000 SF BUILDING AREABUILDING IS APPROXIMATELY 17,000 SF: 17,000 SF/(3.33/1000 SF) =57 STALLSAMPHITHEATRE: 1 STALL PER 3 SEATS, 1 STALL PER 800 SFSTAGE AREAAMPHITHEATRE HAS APPROX. 100 SEATS, STAGE AREAIS APPROX. 800 SF:100 SEATS/3 =34 STALLS800 SF STAGE =1 STALLTOTAL =92 STALLSMAX. ALLOWABLE = 110% OF TOTAL CALCULATED ABOVE92 STALLS*1.10 = 102 STALLSSTALLS PROVIDED:ACCESSIBLE STALLS 7STANDARD STALLS 95TOTAL STALLS 102HGA NO:DATE:NODESCRIPTIONDATECITY OF RICHFIELDWOOD LAKENATURE CENTERNOT FORCONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC.ISSUANCE HISTORY - THIS SHEETLAND USE SUBMITTALDECEMBER 16 20240969-005-0006710 LAKE SHORE DR SRICHFIELD, MN 55423OVERALL SITEPLANC002 WLNC - Parking Lot Count and Planting Requirements 01/02/2025 PARKING INFORMATION MAXIMUM PARKING REQUIREMENTS: BUILDING: 3.33 STALLS PER 1000 SF BUILDING AREA BUILDING IS APPROXIMATELY 17,000 SF: 17,000 SF/(3.33/1000 SF) =57 STALLS AMPHITHEATRE: 1 STALL PER 3 SEATS, 1 STALL PER 800 SF STAGE AREA AMPHITHEATRE HAS APPROX. 100 SEATS, STAGE AREA IS APPROX. 800 SF: 100 SEATS/3 =34 STALLS 800 SF STAGE =1 STALL TOTAL =92 STALLS MAX. ALLOWABLE = 110% OF TOTAL CALCULATED ABOVE 92 STALLS*1.10 = 102 STALLS STALLS PROVIDED: ACCESSIBLE STALLS 7 STANDARD STALLS 95 TOTAL STALLS 102 6287+3(563(&7,9(6287+3(563(&7,9()520%2$5':$/.1$785(3/$<3(563(&7,9(0$,1(175<3(563(&7,9(+*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$(;7(5,255(1'(5,1*6)255()(5(1&(21/<$XWKRU $%&'(5()(572$)250$7(5,$/,'&2'(65()(572$6(5,(6)25'225$1')5$0(7<3(6$1''(7$,/65()(572$6(5,(6)25:,1'2:$1'23(1,1*7<3(6'(9,&(6$5(',0(16,21('72&(17(5/,1(2)'(9,&(812+(,*+76$5()520))(/(9$7,21&21),50(;7(5,25%8,/',1*02817(''(9,&(6$1'),;785(6/2&$7,216:,7+6,',1*/$<28735,2572,167$//&(17(5'(9,&(21%2$5'&225',1$7(/2&$7,21:,7+$5&+,7(&7*(1(5$/127(6(;7(5,25(/(9$7,216/(9(/ 522) $6'1*6'1*6'1*:::::::::60)60)&217$7%$6(60)&217$7'$78060)&217$7%$6($$6(()25(/(9$7,21$7021,725$60)7<3$76,//$ :$//+<'5$176((3/80%&25(7(167((/&2/8016((6758&785$/29(5)/2:'2:163287$/(9(/ 522) 6'1*6(($6&5((1:$//6'1*60)60)&217$7'$7806'1*60)&217$7%$6(&25(7(167((/&2/8016((6758&785$/$$6,0)'.%)'&/(9(/ 522) $6'1*6'1*::::6'1*(;+,%,7522)021,725%(<21'60)&217$7%$6(60)60)&217$7'$780$6(()25$1*/('(/(9$7,2129(5)/2:'2:163287$$$60)7<3$76,///(9(/ 522) $9(*5%(<21'6'1*60)&217$7%$6(::::::::60)60)6(()25(/(9$7,21$7021,725 $60)&217$7'$7806'1*6'1*6(()25(/(9$7,21$7021,725$60)7<3$76,//$ 60)&217$7%$6(29(5)/2:'2:163287:$$$:'75(//,60(7)$%7232)%(1&+/(9(/ 522) $6'1*'$6+('/,1(,1',&$7(6&217,1286*8$5'5$,/$7(/(9$7(''(&.6'1*6'1*60)60)60)60)&217$7'$78060)&217$7%$6(6(()25(/(9$7,21$7021,725$60)7<3$76,// :$//+<'5$176((3/80%:::/(9(/ 522) $6'1*9(*59(*56'1*'(&.$1'*8$5'5$,/6(($60)60)60)60)60)6(($)25(/(9$7,216$7522)6'1*29(5)/2:'2:16328760)&217$7%$6( :$//+<'5$176((3/80%::::::::::::$),3&$7(;326(')281'$7,21%(/2:'(&.$&25(7(167((/&2/8016((6758&785$//(9(/ 522) 6'1*    6(( )25(/(9$7,21$7021,7256'1*60)6'1*6'1*60)&217$7'$78060)&217$7%$6(/95/95$60)&217$7%$6('$6+/,1(,1',&$7(66&5((1:$//6((6+((7$ $ $ $6(($1')25(/(9$7,216$7(;+,%,77(55$&( :$//+<'5$176((3/80%:29(5)/2:'2:1632876'1*%(1&+0(7)$%7232)%(1&+$$7%(1&+$/(9(/ 522) 6'1*6'1*60)'$6+/,1(,1',&$7(66&5((1:$//6((6+((7$60)&217$7%$6(60)&217$7'$780&25(7(13,3(&2/8016((6758&785$/29(5)/2:'2:163287:$//+<'5$176((3/80% $$6,0/(9(/ 522) 6'1*6'1*::::60)6'1*60)&217$7'$78060)&217$7%$6($60)7<3$76,// :$//+<'5$176((3/80%$/(9(/ 522) :6'1*6'1*60)6'1*60)&217$7'$78060)&217$7%$6(&25(7(13,3(&2/8016((6758&785$/60)7<3$76,//:'75(//,6/(9(/ 522) :6'1*60)6'1*60)&217$7'$78060)&217$7%$6(60)7<3$76,//6'1*/(9(/ 522) 6'1*60)6'1*60)7<3$76,//60)&217$7'$7806'1*60)&217$7%$6(:/(9(/ 522) 6'1*6'1*6'1*29(5)/2:'2:16328760)&217$7%$6(60)&217$7'$78060)::'75(//,6/(9(/ 522) 6'1*60)60)&217$7'$7806'1*6'1*60)&217$7%$6( $6(()25$1*/('(/(9$7,216'1*%(1&+:'75(//,60(7)$%7232)%(1&+$6,0$7%(1&+/(9(/ 522) 60)&217$7%$6(:6'1*6'1*3/&6(($+*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$(;7(5,25(/(9$7,216  (;7(5,25(/(9$7,21$7(175<($67  (;7(5,25(/(9$7,21$7(175<1257+  (;7(5,25(/(9$7,21$72)),&(1257+  (;7(5,25(/(9$7,21$708/7,385326(1257+($67  (;7(5,25(/(9$7,21$708/7,385326(1257+:(67  (;7(5,25(/(9$7,21$708/7,385326((;+,%,76287+($67  (;7(5,25(/(9$7,216287+  (;7(5,25(/(9$7,21$70(&+$1,&$/($67  (;7(5,25(/(9$7,21$72)),&(:(67  (;7(5,25(/(9$79(67,%8/(  (;7(5,25(/(9$72)),&(($67  (;7(5,25(/(9$7/281*(  (;7(5,25(/(9$7(;+,%,77(55$&(  (;7(5,25(/(9$7,21$7(;+,%,77(55$&(%(1&+  (;7(5,25(/(903'(&.(175< $%&'(5()(572$)250$7(5,$/,'&2'(65()(572$6(5,(6)25'225$1')5$0(7<3(6$1''(7$,/65()(572$6(5,(6)25:,1'2:$1'23(1,1*7<3(6'(9,&(6$5(',0(16,21('72&(17(5/,1(2)'(9,&(812+(,*+76$5()520))(/(9$7,21&21),50(;7(5,25%8,/',1*02817(''(9,&(6$1'),;785(6/2&$7,216:,7+6,',1*/$<28735,2572,167$//&(17(5'(9,&(21%2$5'&225',1$7(/2&$7,21:,7+$5&+,7(&7*(1(5$/127(6(;7(5,25(/(9$7,216522) $6'1*9(*560) 60)&217$7%$6(2):$//$7522)522) 6'1*60)&217$7%$6(2):$//$7522)60)$ 522) 6'1*6'1*:$60)&217$7%$6(2):$//$7522)   60)6,//60)522) $6'1*60) 60)&217$7%$6(2):$//$7522)522) 6'1*$6'1*   :60)&217$7%$6(2):$//$7522)60)60)6,//522)    6'1*6'1*60)60)&217$7%$6(2):$//$7522)6'1*6'1*60)6,//:$6,0/(9(/ 522) 6'1*60)&217$7'$7806'1*6'1*6(((/(96)25/2&$7,2160)&217$7%$6(60) 726,',1* 726,',1* $$$/(9(/ 522) 726,',1* 726,',1*:':52  6'1*$)66((:,1'2:7<3(660)&217$7'$7806'1*6'1*6(((/(96)25/2&$7,2160)7<3$76,//60)&217$7%$6(60)$$$$$$$596     )  )  )  )  )  )   %2$5'6 )   %2$5'6 )   %2$5'6 )   %2$5'6 )   %2$5'6 *   %2$5'6 *   %2$5'6 *   %2$5'6 *   %2$5'6 *   %2$5'6 6'1*!6'1*!6'1*! +*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$(;7(5,25(/(9$7,216$XWKRU  522)(/(9$7,21$7(;+,%,7($67  522)(/(9$7,21$708/7,385326($($67  522)(/(9$7,21$708/7,385326($1257+  522)(/(9$7,21$708/7,385326(%:(67  522)(/(9$7,21$708/7,385326(&1257+  522)(/(9$7,21$7(;+,%,76287+  (/(9$7,217<3,&$/6,',1*  (/(9$7,217<3$)6  6'1*721*8($1'*5229(6,',1*/$<287',$*5$0 $..//00$$$$&ϭϵ&ϮϬ&Ϯϭ&Ϯϭ5()(572$')/2253/$1$5($'1276+2:1)25&/$5,7<&ϯϮ&%87,/,7<<$5'$87,/,7<<$5'%87,/,7<<$5'&&ϭϵ$$$$&ϱϭ&ϱϭ$/7(51$7(612:0(/75()(572&29(56+((76'1*!)$&('6&5((1:$//60)!&217,18286&$3$76&5((1:$//[3267:,7+[+25,=217$/)5$0,1*)855,1*)256'1*$77$&+0(176((6758&785$/)25)5$0,1*6(&7,215 5     6'1*!)$&('6&5((1:$//60)!&217,18286&$3$76&5((1:$//[3267:,7+[+25,=217$/)5$0,1*)855,1*)256'1*$77$&+0(176((6758&785$/)25)5$0,1*6(&7,21  5    $%&'()*+,-./‡‡0$//,17(5,253$57,7,2166+$//%($D81/(66127('27+(5:,6(3/$1',0(16,216$5()520)$&(2)3$57,7,217<3($1''2127,1&/8'($33/,('),1,6+(681/(66127('27+(5:,6(3/$1',0(16,216,1',&$7('$6+2/'25&/($5',0(16,216$5()520)$&(2)$33/,('),1,6+,167$//:25.675$,*+73/80%/(9(/648$5($1'758(,13523(5$/,*10(17)/$71(66/(9(/)/225672758(3/$1(:,7+,1,1&+ 00 ,1 Ť 0 :+(17(67('%<7(1)227 0 675$,*+7('*(3/$&('$1<:+(5(21)/225,1$1<',5(&7,21&225',1$7()851,785(5(/$7('(/(&75,&$//$<287:,7+)851,785(9(1'25:+(5(+$1'5$,/6*5$%%$56&$%,1(76:$//02817(''225672362527+(5:$//+81*,7(06$5($77$&+('723$57,7,216,167$//%$&.(53/$7(6>25:22'%/2&.,1*@$&&85$7(/<326,7,21('$1'),50/<6(&85('720(7$/678'6:+(7+(52512768&+%$&.(53/$7(625%/2&.,1*$5(,1',&$7('21'5$:,1*6:+(5(1(::25.$%876$/,*1625$'-2,16(;,67,1*0$7(5,$/60$.(60227+$1'(9(175$16,7,21$1'(/,0,1$7((9,'(1&(2)3$7&+,1*$1'5(),1,6+,1*),1,6+1(::25.720$7&+$'-$&(1781',6785%('685)$&(681/(66127('27+(5:,6(&/26($1'3$7&++2/(6$1'23(1,1*6,1(;,67,1*)/225:$//$1'&(,/,1*:+,&+(;,67255(68/7)520'(02/,7,2125$/7(5$7,21:25.720$7&+$'-$&(1781',6785%('685)$&(635,2572&21&($/0(172)),5(5(6,67,9(0$7(5,$/6%<27+(5:25.3$7&+$1'5(3$,5$5($62)5(029('25'$0$*('$33/,('),5(3522),1*&203/(7(3$7&+,1*$1'5(3$,5720$,17$,1(;,67,1*),5(5(6,67$1&('(6,*1,1$&&25'$1&(:,7+),5(3522),1*0$18)$&785(5 6:5,77(1,16758&7,216)25&21',7,2162)(;32685($1',17(1'('86(&225',1$7(7(67,1*$1',163(&7,212)$66(0%/,(6$65(48,5('%<$87+25,7,(6+$9,1*-85,6',&7,213529,'(),5(67233,1*2)3(1(75$7,216$1'92,'67+528*+),5(5$7(':$//)/225$1'3$57,7,21$66(0%/,(6>$1'522)@,1&/8',1*(037<23(1,1*6$1'23(1,1*6&217$,1,1*&$%/(63,3(6'8&76&21'8,7$1'27+(5(/(0(1763529,'($//&2'(5(48,5('6,*1$*(6,*1!)252&&83$1&<0(&+$1,&$/(/(&75,&$/(7&&225',1$7(:,7+2:1(5 66,*1$*(9(1'25)25'(6,*1$1'0$7(5,$/,7<$76281'5$7('3$57,7,21:$//63529,'(&217,18286%($'2)$&2867,&$/6($/$17$7-81&785(2)%27+)$&(62)5811(56253/$7(6:,7+)/225$1'&(,/,1*&216758&7,21$1':+(5(9(5*<3680%2$5'$%876',66,0,/$50$7(5,$/6$723(1,1*6$1'&872876),//23(163$&(6%(7:((1*<3680%2$5'$1'),;785(6&$%,1(76'8&76$1'27+(5)/86+253(1(75$7,1*,7(06:,7+&217,18286%($'2)6($/$176($/6,'(6$1'%$&.62)(/(&75,&$/%2;(672&203/(7(/<&/26(2))23(1,1*6$1'-2,1763529,'($&&(663$1(/6$3!$65(48,5(')25$&&(66720(&+$1,&$/$1'3/80%,1**(1(5$/127(6)/2253/$1/(9(/ 522) $ $6'1* 6'1*/(9(/ 522)  6'1*/(9(/ 522) $ 6'1*6'1*/(9(/ 522)  6'1*+*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5.(<3/$1$5($'/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$87,/,7<<$5'3/$1 '(7$,/6$XWKRU  87,/,7<6&5((1:$//.(<127(6)/2253/$1 'HVFULSWLRQ) '$6+('/,1(,1',&$7(6('*(2)522)2562)),7$%29() &$7(5,1*:$50,1*&$576127,16&23() )/225'5$,16((3/80%,1*) ),5($/$50$1181&,$7253/$1(/5()(572),5(3527(&7,21) '225$&78$725/2&$7,215()(572+$5':$5(*52836,1'2256&+('8/() 5(&(66(':$//&$%,1(781,7+($7(56((0(&+$1,&$/) ),5('(3$570(17&211(&7,216(((;7(5,25(/(9$7,216$1'5()(572),5(3527(&7,21) :$//02817352-(&7256((7(&+12/2*<) 3529,'('8$/6,'('(/(&75,&),5(3/$&() 5$',$17)/2250$1,)2/'6((0(&+$1,&$/) (;7(5,25+26(%,%6((3/80%,1*) $9(4!&(,/,1*+81*02725,=('352-(&7,216&5((16((5&3) 2:6!23(5$%/(:$//6<67(0) 6+(/9,1*%<2:1(5 2)2, ) 021,725',63/$<$1'%5$&.(76((7(&+12/2*<) 5(86((;,67,1*,17(5,25),5(3/$&()25(;7(5,25$33/,&$7,21)/8($77$&+('723(5*2/$$1'72(;7(1'72&2'(5(48,5('+(,*+7%(<21'522)1(:+,*+%$6($7',$2872)6721(0$6215<720$7&+/$1'6&$3,1*) &(,/,1*+81*&25'5((/&(17(5('29(5,6/$1'6(((/(&$1'5&3) 3529,'(  &2/25&+$1*,1*/('/,*+7(':$//3$1(/6$1'&2/25&+$1*,1*/('&29(/,*+7$7833(53(5,0(7(52)5220) (/(&75,&$/(48,30(176(((/(&75,&$/) 75$6+%,1%<2:1(5) 5(&<&/,1*%,1%<2:1(5) :$//02817(':$6+'2:167$7,216((3/80%,1*) :$//02817(''5<,1*5$&. 2)&, ) 7$1.6$1'6758&785(%<(;+,%,7'(6,*1(56(((;+,%,73/$16) :$//028173+21(6(((/(&) 02%,/(612:6+2(5$&.6 2)2, ) 02%,/(,6/$1' 2)2, ) 23(1$5($)25$//7(55$,1:+((/&+$,53$5.,1* 2)2, $1'&+$5*,1*) 0(7)$%!%(1&+723:,7+6'*1!)$&(6(($) )/2256,1.6((3/80%,1*) )'.%!),5('(3$570(17.(<%2;)25),5('(3$570(17$&&(66) )/225&23,(52)2,) :25.%(1&+2)2,) 0236,1.6((3/80%,1*) 87,/,7<6,1.6((3/80%,1*) 67$,1/(6667((/:25.,6/$1'2)2,) 0.%'!&)&,6(($6(5,(6(/(9$7,216)257<3() (;+,%,7'(6,*1%<27+(56) (/(&75,&:$7(5&22/(5:,7+%277/(),//(56((3/80%,1*) 0)3/!(/(&75,&),5(3/$&(81,7) :$//23(1,1*672$&&(37(;+,%,77$1.6$1'',63/$<6%<(;+,%,7'(6,*1(5) 3529,'()8//+(,*+73/$<:22'%$&.(5217+,6:$//2525,(17:$//:,7+6+($7+,1*7+,66,'($76+($5:$//&21',7,21:$//02817('(;+,%,7%<27+(56) &867200,//:25.%(1&+:6725$*(%(/2:)$%5,&!$1'83+!&86+,216(($6(5,(6) '8$/+(,*+7&2$7+22.6&+!(17,5(/(1*7+2):$//,1',&$7(') '225$&78$725$1'&$5'5($'(502817('7267/78%(%2//$5'+3&!),1,6+6((6+((7$) 67((/6+,36/$''(50(7)$%!3$,17),1,6+) 672236((6758&785$/) 5(&(66('6833/<*5,//(&225',1$7(/2&$7,21:,7+0(&+$1,&$/$1'6758&785$/) $67!$&2867,&$/:$//3$1(/66((6+((76(5,(6$(/(9$7,216)257<3(6) 67((/&2/8016((6758&785$/3$,17+3&!) 6'1*!$7:$//5(785172:,1'2:) 6'1*!$7:$//5(785172:,1'2:  (/(9$7,2187,/,7<6&5((1:$//6287+  (/(9$7,2187,/,7<6&5((1:$//:(67  (/(9$7,2187,/,7<6&5((1:$//($67  (/(9$7,2187,/,7<6&5((1:$//1257+ BB B9(67,%8/(9(67,%8/($1,0$/&$5((;+,%,7/2%%<0(&+$$&21)5(17$//281*(%0(&+$1,&$/)$0,/<7/7(/(&7(/&20:$7(50$,17(1$1&($9$%&'((./0)*+    /281*($2)),&(&21)%6725:25.63$&(.,7&+(1(77(2)),&(67$))72,/(75(&(37,216(1625<08/7,385326(&08/7,3853326(%08/7,385326($6725*5283(175<+3&/6767256725+3&/67+3&/67&$7(5,1*5(6752206/$&7$7,21)$0,/<55&,5&&,5&5(17$/6725&8676725$*(352*5$06725$*(75$6+5(&<&/,1*2)),&(2)),&(2)),&(+3&/67+3&/6723(12)),&(67$))(175<)(($-,5()(572$)25(1/$5*(''(&.3/$1$5($&$5($%$5($& $5($%$5($$$5($%$5($$$5($%$5($'$5($&$5($'$5($&$/7(51$7(612:0(/76,7(6+2:1)25&217(;721/<5()(572&,9,/$1'/$1'6&$3('5$:,1*6287'2256($7,1*$5($287'2256($7,1*$5($+*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5.(<3/$1$5($$$5($%$5($'$5($&/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$)/2253/$129(5$//$XWKRU  )/2253/$129(5$// GAS18" RCP ST S15" RCPUGEUGEUGEUGEUGEUGEB I T U M I N O U SB I T U M I N O U SGRAVELPATHB I T U M I N O U SB I T U M I N O U SB I T U M I N O U SGRAVELGRAVELGRAVELCONCRETEBITUMINOUSCONCRETECONCRETECONCRETECONCRETEBITUMINOUSCONCRETE WALL6 FT WOOD FENCE6 FT CHAIN LINK FENCE6 FT CHAIN LINK FENCECONCRETESHORE LINE PER PLATBENCHESEMBENCHSIGNEMHPKSPKSPKSPKSSIGNMBSIGNSIGNEMHHHFPKSPKSPKSPKSPKSPKSPKSPKSPKSPKSPKSSIGNTRANSSIGNSIGNWVTLWVHYDWVWVPKSPKSSIGNBENCHBENCHBENCH825835835830830835840845850845845840835830835840830830830830825825825830830830830830835835835824824823826829826827828829831827826829828824828827826823822822823824826827828828823822824822823824824823826826828828827828829827829829829828829827827831831833832831833832831834833832831831832832831829828827827828829829828829831828829822823824826849848847846844843842841839838837836834833832831833834836837838839841842837838839836843841842844846847848849834833832831836827832WOOD LAKEWETLANDLAKE SHORE DRIVEEXISTING PARKING LOTEXISTING TRAILEXISTING PARKING LOT1OHWL BUFFERWETLAND BUFFERWOOD LAKEWETLANDLAKE SHORE DRIVEEXISTING TRAILOHWL BUFFERWETLAND BUFFERPROPERTY LINE111111100010011787100410031002100810061007100910101005ONLY THOSE PERSONS AUTHORIZED BY THE CITY MAY REMOVE ANY TREES FROM PUBLIC LAND. TREES REMOVED FROM ANY PUBLIC LAND INCLUDING CITY, COUNTRY OR STATE RIGHT-OF-WAY SHALL BE REPLACED BY THE PERSON OR ENTITY WHO REMOVED IT. REPLACEMENT SHALL BE IN THE FOLLOWING MANNER: A. REPLACEMENT OF ANY LIVE TREE WHICH IS REMOVED FROM ANY PUBLIC LAND SHALL BE REQUIRED ON A CALIPER INCH FOR CALIPER INCH BASIS. THE CITY MAY ALSO ELECT TO RECEIVE CASH IN LIEU OF TREES BASED ON FREE PER CALIPER INCH DETERMINED BY THE CITY COUNCIL.B. REPLACEMENT TREES SHALL BE OF SPECIES APPROVED BY THE CITY FORESTER. GENERAL NOTES - TREE REMOVALLEGEND - TREE REMOVALEXISTING TREE TO BE TRANSPLANTEDEXISTING TREE TO BE REMOVEDEXISTING TREE TO BE PROTECTEDLIMITS OF CONSTRUCTIONHGA NO:DATE:NO DESCRIPTIONDATECITY OF RICHFIELDWOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC.ISSUANCE HISTORY - THIS SHEETLAND USE SUBMITTALDECEMBER 16, 20240969-005-006710 LAKE SHORE DR SRICHFIELD, MN 5542312/12/2024 2:08:56 PM C:\Users\laluken\Documents\Revit Local Files\L24_Wood Lake Nature Center_0969-005-00_LNicholsLR7H9.rvtL100OVERALL TREEPROTECTIONPLANAuthor1" = 30'-0"1OVERALL TREE PROTECTION PLANKEYNOTES - TREE PROTECTION# DESCRIPTION1 TREE PROTECTION FENCING, TYP. REFER TO DETAILS ON SHEET L120TYP.TYP.TYP.TREE TRANSPLANT SCHEDULEKEY TREE SPECIES TREE SIZE HEALTH1000 MAPLE 4" CAL. GOOD1001 MAPLE 4" CAL. GOOD1002 MAPLE 2" CAL. GOOD1003 MAPLE 3" CAL. GOOD1004 MAPLE 2" CAL. GOOD1005 MAPLE 4" CAL. GOOD1006 MAPLE 4" CAL. GOOD1007 MAPLE 4" CAL. GOOD1008 MAPLE 2" CAL. GOOD1009 MAPLE 2" CAL. GOOD1010 MAPLE 2" CAL. GOOD1011 MAPLE 2" CAL. GOOD1787 RED MAPLE 4.5" CAL. GOOD 8 3 0 830 835825 8 2 5 8 3 0 8 3 0 830 835 826 8 2 7 828 823 8 2 2824 8 2 2 823 824 824 823 826 8 2 6 828827828829 8 2 7 8 2 9 8 2 9 829 828 8328 3 3 8 3 2 8 3 1 8 3 1 8 3 2 832826 8368 3 4 8 3 3 8 3 2 8 3 1 1 2 3 6 10 12 13 14 3 4 5 6 6 7 8 8 8 9 15 11 11 6 6 16 6 7 8 8 8 8 8 11 EXISTING PARKING LOT 17 17 17 17 17 WETLANDWETLAND 8 88 8 8 8 8 8 8 8 6 18 TYP. 18 TYP. 18 TYP. CONC FIN-32 CONC FIN-32 PVR-1 SITE-1 SITE-2 STN-1 STN-1 STN-1 STN-1 STN-1 STN-1 STN-1 STN-2 STN-3 STN-3 STN-4 TYP. STN-5 TYP. STN-6 STN-7 TYP. STN-8 TYP. FURN-1 TYP. FURN-1 TYP. 19 19 19 19 19 19 22 25 24 24 TYP. 26 26 26 26 26 26 1 L210 1 L220 3 L220 2 L220 4 L220 6 L220 9 L220 27 28 28 12 L220 12 L220 12 L220 12 L220 L221 1 5 L220 8 L220 7 L220 1. UTILIZE "CALL 811" UTILITY LOCATION PRIOR TO ALL EXCAVATION ACTIVITY. 2. REFER TO CIVIL DRAWINGS FOR ADDITIONAL SITE INFORMATION 3. CONTRACTOR TO OBTAIN DIGITAL DRAWING FILE FOR LAYOUT OF LOCATION VERIFICATION OF ALL SITE AND LANDSCAPE FEATURES 4. CONTRACTOR RESPONSIBLE FOR VERIFYING ALL QUANTITIES 5. CONTRACTOR RESPONSIBLE FOR COORDINATING ALL WORK WITH ADJACENT GOLF COURSE WORK. 6. CONTRACTOR TO FIELD COORDINATE PLACEMENT/LAYOUT OF BOULDERS WITH LANDSCAPE ARCHITECT PRIOR TO INSTALLATION. GENERAL NOTES LEGEND C.I.P. CONCRETE SURFACING SEE CIVIL NARRATIVE STONE SURFACING 1 SEE SPEC. 321540 STONE SURFACING 2 SEE SPEC. 321540 STONE STEP 1 REFER TO SPEC. 321540 STONE SEAT WALL REFER TO SPEC. 321540 STEEL EDGING REFER TO SPEC. 321540 BOULDER 1 REFER TO SPEC. 321540 STONE SURFACING 3 SEE SPEC. 321540 BOULDER 2 REFER TO SPEC. 321540 ENGINEERED WOOD FIBER SURFACING SEE SPEC. 321540 PAVER SURFACING 1 SEE SPEC. 321540 BIKE RACK REFER TO SPEC. 321540 SITE FURNISHINGS BY OWNER FLAGSTONE REFER TO SPEC. 321540 LIMITS OF CONSTRUCTION LIGHITNG REFER TO CIVIL DWGS. TABLE & CHAIRS FF&E BIKE RACK REFER TO SPEC. 321540 EXISTING TREE KEYNOTES # DESCRIPTION 1 REINFORCED CONCRETE DRIVE; REFER CIVIL DWGS. 2 DRY CREEK; REFER CIVIL DWGS. 3 BICYCLE PARKING; REFER TO SPEC. 321540 4 EV CHARGING STATIONS; REFER TO CIVIL & ELECTRICAL DWGS. 5 SIGNAGE; PROVIDE 12" DIA. C.I.P. CONCRETE SONOTUBE FOOTINGS TO FROST; TYP. FOR ALL SIGNAGE; LOCATIONS TO BE FINALIZED IN CD; PROVIDE 10 QUANTITY; PROVIDE ELECTRICAL HOOKUP FOR (1) SIGN 6 EXISTING TREES, SAVE & PROTECT 7 FENCE;MECHANICAL YARD 8 PLANTING AREA 9 SALVAGED EXISTING FIREPLACE; REFER TO ARCH. DWGS. 10 FIRE PIT; FF&E 11 KIOSK, TYP; PROVIDE 12" DIA. C.I.P. CONCRETE SONOTUBE FOOTING TO FROST 12 NATURE PLAY AREA 13 SALVAGED EXISTING WOOD TRUNK, SEE SPEC. 310000 14 BIRD FEEDING & OBSERVATION AREA 15 SALVAGED DONOR BENCH, TYP. 16 TRANSFORMER; REFER TO ELEC. DWGS. 17 BLDG. OVERHANG 18 LUMINAIRE; REFER TO LIGHTING DWGS. & E500 19 STORMWATER OVERFLOW; REFER TO PLUMBING DWGS. 22 WETLAND BUILDING SETBACK 23 EX. TRAIL; REFER TO CIVIL DWGS. 24 EX. SITE FEATURE; REFER TO CIVIL DWGS. 25 ORDINARY HIGH WATER LINE BUILDING SETBACK 26 UTILITY FEATURE; REFER CIVIL DWGS. 27 AMPHITHEATER; REFER TO L210 FOR DETAILS 28 ADD ALTERNATE #1, SNOW MELT; REFER TO MECH. DWGS. 1/16" = 1'-0"1 Layout and Materials Plan HGA NO: DATE: NO DESCRIPTION DATE CITY OF RICHFIELD WOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC. ISSUANCE HISTORY - THIS SHEET LAND USE SUBMITTAL DECEMBER 16, 2024 0969-005-00 I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED LANDSCAPE ARCHITECT UNDER THE LAWS OF THE STATE OF MINNESOTA NAME: DATE: REGISTRATION NUMBER: 6710 LAKE SHORE DR S RICHFIELD, MN 55423 12/12/2024 2:09:11 PM C:\Users\laluken\Documents\Revit Local Files\L24_Wood Lake Nature Center_0969-005-00_LNicholsLR7H9.rvtL201 LAYOUT & MATERIALS PLAN Author0 16'64'32' 83083083582582583083083083582682782882382282482282382482482382682682882782882982782982982982883283383283183183283282683683483383283124322222EXISTING PARKING LOT33333WETLANDWETLAND25TYP. 5TYP. 5TYP. 986677777711010ViJ / 16AgA / 2AgACcNTRANS / 5TRANS / 5TRANS / 3ViJ / 5ViJ / 16ViP / 3CcN / 2AgA / 1CaC / 2IlV / 20FoM / 11CsB / 33ViT / 9LEGEND - PLANTINGBEE LAWNREFER TO SPEC. 329219UPLAND SHORTGRASS PRAIRIE SEED MIXREFER TO SPEC. 329219STEEL EDGINGREFER TO SPEC. 321540LIMITS OF CONSTRUCTIONLIGHITNGREFER TO CIVIL DWGS. TABLE & CHAIRSFF&EBIKE RACKREFER TO SPEC. 321540WOODLAND SEED MIXREFER TO SPEC. 329219WETGRASS PRAIRIE SEED MIXREFER TO SPEC. 329219NO MOW FESCUEREFER TO SPEC. 329219EXISTING TREEORNAMENTAL NATIVE PLANTINGS#1 CTNR. O.C. PERENNIALS; CATMINT, PRAIRIE DROP SEED, LITTLE BLUE STEM, OR SIMILAR; REFER TO SPEC. 3290001. UTILIZE "CALL 811" UTILITY LOCATION PRIOR TO ALL EXCAVATION ACTIVITY.2. REFER TO L440 FOR PLANT MATERIAL SCHEDULE3. REFER TO L200s & CIVIL DRAWINGS FOR ADDITIONAL SITE INFORMATION. 4. CONTRACTOR TO OBTAIN DIGITAL DRAWING FILE FOR LAYOUT AND LOCATION VERIFICATION5. CONTRACTOR RESPONSIBLE FOR VERIFYING ALL QUANTITIES. GENERAL NOTES - PLANTING PLAN1/16" = 1'-0"1PLANTING PLANHGA NO:DATE:NODESCRIPTIONDATECITY OF RICHFIELDWOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC.ISSUANCE HISTORY - THIS SHEETLAND USE SUBMITTALDECEMBER 16, 20240969-005-00I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED LANDSCAPE ARCHITECT UNDER THE LAWS OF THE STATE OF MINNESOTANAME:DATE:REGISTRATION NUMBER:6710 LAKE SHORE DR SRICHFIELD, MN 5542312/12/2024 2:09:37 PM C:\Users\laluken\Documents\Revit Local Files\L24_Wood Lake Nature Center_0969-005-00_LNicholsLR7H9.rvtL401PLANTING PLANAuthor016'64'32'KEYNOTES - PLANTING# Description1 TRANSFORMER, REFER TO ELEC. DWGS.2 EXISTING TREES, SAVE & PROTECT3 BLDG. OVERHANG4 BIRD FEEDING & OBSERVATION AREA5 LUMINAIRE; REFER TO LIGHTING DWGS. & E5006 EX. SITE FEATURE; REFER TO CIVIL DWGS.7 UTILITY FEATURE; REFER CIVIL DWGS.8 ORDINARY HIGH WATER BUILDING SETBACK9 WETLAND BUILDING SETBACK10 SCREENING HEDGE 830830828829829828CcN / 3CeOCeO1. UTILIZE "CALL 811" UTILITY LOCATION PRIOR TO ALL EXCAVATION ACTIVITY.2. REFER TO L440 FOR PLANT MATERIAL SCHEDULE3. REFER TO L200s & CIVIL DRAWINGS FOR ADDITIONAL SITE INFORMATION. 4. CONTRACTOR TO OBTAIN DIGITAL DRAWING FILE FOR LAYOUT AND LOCATION VERIFICATION5. CONTRACTOR RESPONSIBLE FOR VERIFYING ALL QUANTITIES. GENERAL NOTES - PLANTING PLANLEGEND - PLANTINGBEE LAWNREFER TO SPEC. 329219UPLAND SHORTGRASS PRAIRIE SEED MIXREFER TO SPEC. 329219STEEL EDGINGREFER TO SPEC. 321540LIMITS OF CONSTRUCTIONLIGHITNGREFER TO CIVIL DWGS. TABLE & CHAIRSFF&EBIKE RACKREFER TO SPEC. 321540WOODLAND SEED MIXREFER TO SPEC. 329219WETGRASS PRAIRIE SEED MIXREFER TO SPEC. 329219NO MOW FESCUEREFER TO SPEC. 329219EXISTING TREEORNAMENTAL NATIVE PLANTINGS#1 CTNR. O.C. PERENNIALS; CATMINT, PRAIRIE DROP SEED, LITTLE BLUE STEM, OR SIMILAR; REFER TO SPEC. 329000HGA NO:DATE:NODESCRIPTIONDATECITY OF RICHFIELDWOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC.ISSUANCE HISTORY - THIS SHEETLAND USE SUBMITTALDECEMBER 16, 20240969-005-00I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED LANDSCAPE ARCHITECT UNDER THE LAWS OF THE STATE OF MINNESOTANAME:DATE:REGISTRATION NUMBER:6710 LAKE SHORE DR SRICHFIELD, MN 5542312/12/2024 2:09:38 PM C:\Users\laluken\Documents\Revit Local Files\L24_Wood Lake Nature Center_0969-005-00_LNicholsLR7H9.rvtL410ENLARGEDPLANTING PLANAuthor1/8" = 1'-0"1ENLARGED PLANTING PLAN - PARKING ISLANDKEYNOTES - PLANTING# Description1 TRANSFORMER, REFER TO ELEC. DWGS.2 EXISTING TREES, SAVE & PROTECT3 BLDG. OVERHANG4 BIRD FEEDING & OBSERVATION AREA5 LUMINAIRE; REFER TO LIGHTING DWGS. & E5006 EX. SITE FEATURE; REFER TO CIVIL DWGS.7 UTILITY FEATURE; REFER CIVIL DWGS.8 ORDINARY HIGH WATER BUILDING SETBACK9 WETLAND BUILDING SETBACK10 SCREENING HEDGE 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2.0 2.4 0.5 1.7 2.3 2.7 2.7 0.5 0.7 0.8 1.0 1.3 1.6 2.0 2.1 2.1 0.4 0.5 0.6 0.7 0.8 0.9 1.2 1.4 1.5 1.5 1.3 0.9 0.4 0.5 0.5 0.5 0.6 0.7 0.9 1.0 1.2 1.2 1.1 0.8 0.5 0.4 0.5 0.5 0.5 0.5 0.5 0.6 0.7 0.8 1.0 1.1 1.0 0.8 0.6 0.5 0.5 0.5 0.5 0.5 0.5 0.6 0.7 0.8 0.9 1.0 1.0 0.9 0.5 0.6 0.6 0.6 0.5 0.5 0.5 0.6 0.7 0.8 0.9 1.0 1.0 1.0 0.9 0.7 0.8 0.8 0.7 0.6 0.6 0.6 0.6 0.7 0.8 0.9 1.0 1.1 1.2 1.3 1.2 0.7 0.7 0.9 1.0 1.1 1.0 0.9 0.8 0.7 0.7 0.8 0.9 0.9 1.1 1.3 1.5 1.8 1.7 0.5 0.9 1.3 1.5 1.5 1.4 1.2 1.1 1.0 0.9 0.9 0.9 1.0 1.2 1.5 2.0 2.2 2.0 0.4 0.9 1.6 2.1 2.2 2.2 1.8 1.5 1.3 1.1 1.0 1.0 1.1 1.3 1.8 2.6 2.8 0.3 0.3 0.5 1.1 2.1 2.5 2.0 1.6 1.3 1.1 1.1 1.2 1.5 2.1 2.8 0.3 0.4 0.4 0.5 0.8 2.6 2.3 1.8 1.4 1.2 1.1 1.2 1.5 2.0 2.4 0.3 0.4 0.5 0.6 0.6 0.7 1.2 1.8 1.6 1.2 1.0 1.0 1.1 1.4 1.9 0.3 0.5 0.6 0.7 0.8 0.8 0.7 0.7 0.7 0.7 1.3 0.3 0.4 0.5 0.7 0.9 1.1 1.1 0.8 0.3 0.4 0.3 0.5 0.6 0.9 1.2 1.5 1.5 0.3 0.4 0.5 0.8 1.1 1.6 1.9 0.4 0.5 0.7 1.0 1.4 2.2 2.5 0.4 0.5 0.6 0.8 1.2 1.8 2.6 0.4 0.4 0.5 0.7 0.9 1.3 1.9 2.5 0.4 0.5 0.6 0.7 0.9 1.3 1.9 0.4 0.5 0.5 0.6 0.7 0.8 1.1 1.4 0.5 0.5 0.6 0.6 0.6 0.6 0.7 0.4 0.6 0.6 0.7 0.6 0.6 0.5 0.4 0.4 0.5 0.7 0.8 0.8 0.8 0.6 0.3 2.0 0.6 0.5 0.6 0.9 1.1 1.2 1.1 0.7 1.1 0.8 0.6 0.6 0.8 1.1 1.5 1.7 1.6 0.8 1.4 0.6 0.6 0.6 0.8 1.1 1.6 2.1 2.2 1.8 0.6 0.6 0.8 1.1 1.5 2.2 2.8 2.6 0.7 0.8 1.0 1.3 1.8 2.4 3.1 2.1 1.0 0.9 1.1 1.4 1.9 2.3 2.1 2.6 2.5 1.2 1.1 1.3 1.6 2.0 2.8 0.9 1.1 1.6 2.3 0.9 1.2 1.6 2.0 0.9 0.9 1.2 1.4 0.8 0.9 1.0 1.0 0.7 0.7 0.7 0.5 0.5 0.4 0.8 0.9 1.0 0.9 0.7 1.0 1.1 0.9 0.6 0.7 1.0 1.2 1.3 1.1 0.9 0.5 0.7 1.1 1.3 1.6 1.6 1.5 1.0 0.3 0.6 1.1 1.4 1.8 2.0 2.1 1.5 0.6 1.0 1.3 1.8 2.3 2.8 2.6 1.4 1.1 1.2 1.6 2.0 2.8 1.6 1.3 1.3 1.3 1.6 2.1 1.0 1.3 1.2 1.2 1.5 1.6 1.1 1.2 1.3 1.2 1.0 1.1 1.3 1.3 1.5 1.2 0.7 1.4 1.6 1.7 1.1 0.3 1.4 1.8 2.2 1.1 1.5 2.0 2.7 1.1 1.6 2.3 3.8 1.1 1.6 2.2 1.1 1.5 1.9 1.0 1.4 1.7 1.9 1.2 1.3 1.4 0.5 1.0 1.0 1.0 0.5 0.7 0.6 0.9 1.8 1.7 0.6 0.1 2.0 1.6 0.5 0.1 0.1 0.1 1.9 0.1 0.1 1.9 2.5 2.6 2.3 1.9 2.8 2.2 1.8 2.3 1.5 3.1 1.5 2.3 1.0 2.9 2.1 4.8 3.0 2.9 2.3 2.1 2.1 1.7 3.2 2.5 2.5 2.3 2.2 1.8 1.7 5.9 1.9 1.8 1.9 2.5 2.3 2.3 2.1 1.8 2.1 2.4 2.0 0.3 0.8 0.2 0.3 0.3 0.5 0.8 2.0 0.1 0.2 0.2 0.2 0.3 0.3 0.4 0.5 0.8 1.6 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.4 0.5 0.6 0.8 1.2 2.1 6.2 0.2 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.9 1.0 1.2 1.6 1.8 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.0 1.2 1.4 1.5 1.5 1.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.7 0.9 1.3 1.6 1.9 2.0 1.8 0.3 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.1 1.6 2.1 2.5 2.7 2.4 1.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.2 1.8 2.4 3.0 3.2 2.9 0.3 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.2 1.8 2.4 3.0 3.1 0.7 0.2 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 1.1 1.5 2.1 2.6 1.2 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.9 1.2 1.9 2.6 0.3 0.2 0.2 0.2 0.3 0.4 0.5 0.9 3.3 0.7 0.7 0.3 0.9 0.7 1.0 4.5 6.6 7.4 3.2 7.4 3.7 4.4 7.2 6.3 7.2 6.8 6.4 7.7 4.6 2.8 7.0 6.4 3.1 1.6 2.5 2.0 5.1 7.0 8.0 7.9 7.9 7.6 7.2 3.1 5.0 2.5 1.0 0.5 5.1 8.4 2.9 1.0 1.0 5.5 8.1 6.7 4.6 7.4 8.3 7.2 7.2 5.7 0.1 0.2 1.5 2.9 0.6 0.2 0.1 1.0 2.5 0.5 1.2 4.2 3.5 0.8 0.2 0.3 0.6 0.3 2.4 8.4 8.3 2.1 0.3 0.3 1.1 1.1 1.7 6.2 5.8 0.2 1.7 6.8 6.3 1.5 0.9 0.9 0.4 2.5 8.4 8.2 4.8 6.4 2.1 1.0 3.2 3.7 8.5 8.3 3.5 0.4 1.9 6.4 8.7 6.4 4.6 1.1 0.6 1.1 1.4 6.2 8.3 3.5 1.1 0.3 0.7 0.9 3.7 6.7 2.9 1.6 2.1 0.3 0.7 3.7 0.9 0.4 0.2 1.1 2.9 7.5 7.9 4.8 0.6 1.6 2.8 0.6 0.3 0.6 0.3 0.2 0.5 4.4 8.4 7.3 5.2 2.0 1.1 1.0 0.5 0.2 0.1 0.1 0.3 0.6 0.7 4.4 8.3 5.1 0.2 0.3 0.1 0.1 0.1 0.3 2.7 5.3 2.4 1.3 2.2 2.4 0.8 0.2 0.1 0.7 2.0 6.8 7.8 5.3 0.7 1.8 0.8 0.2 0.4 3.9 8.2 6.9 6.5 2.7 0.7 1.0 0.3 0.6 5.2 8.1 5.5 1.3 1.8 2.3 0.3 0.6 2.0 3.4 1.6 2.4 0.7 0.7 0.6 1.3 1.9 2.3 1.5 2.2 2.0 0.8 1.0 1.9 0.2 0.2 0.3 7.5 8.6 9.7 8.5 8.8 7.4 8.7 7.5 6.5 5.5 2.5 3.1 5.2 6.4 7.1 5.7 1.0 0.2 1.3 5.4 3.1 0.9 1.0 1.1 1.8 3.2 2.0 0.3 1.0 4.6 2.6 1.7 4.6 1.8 0.8 0.9 0.5 1.6 5.0 2.1 2.2 4.3 1.2 0.6 0.9 0.8 2.3 4.9 0.7 0.4 0.3 0.8 0.5 0.3 1.9 1.5 0.8 2.7 2.2 1.8 2.1 2.0 2.3 2.0 2.7 2.6 2.2 0.6 1.1 2.0 2.8 2.6 0.4 0.4 1.8 1.7 1.4 1.1 1.9 2.8 2.7 2.4 0.4 0.4 1.2 2.1 1.7 4.3 1.8 1.5 1.7 2.2 1.8 2.1 1.4 1.0 1.9 2.2 2.2 0.4 0.4 0.4 1.5 2.2 2.1 1.7 2.0 2.0 1.2 1.0 1.4 1.5 3.2 1.7 1.9 1.4 1.2 1.7 2.1 2.0 4.6 2.1 2.1 1.2 0.7 0.5 0.4 0.4 1.9 2.3 1.9 1.4 1.0 1.0 1.7 2.1 1.7 1.7 2.0 1.5 0.8 0.9 1.7 1.7 2.0 1.8 2.1 1.4 0.9 1.1 1.8 1.9 1.1 0.6 0.4 0.4 0.4 2.3 2.2 2.0 1.8 1.3 0.8 1.0 1.6 2.0 2.0 2.0 1.0 0.8 0.5 0.4 0.4 2.0 2.0 2.7 0.7 0.6 0.6 0.4 0.5 0.4 0.4 0.4 0.9 1.7 2.1 1.8 1.8 2.1 1.7 1.1 1.3 2.0 1.8 4.4 0.3 0.3 0.4 0.4 1.2 1.3 1.4 1.7 2.2 2.3 2.2 2.0 1.4 1.1 1.2 1.8 2.3 0.3 0.3 0.4 5.3 1.7 2.0 1.2 0.7 0.8 1.6 2.0 1.9 2.1 2.7 3.7 4.7 2.5 4.2 3.1 2.5 3.5 2.9 3.0 3.2 3.1 4.4 0.6 0.4 0.4 1.8 1.9 1.4 0.9 0.5 0.9 1.6 2.0 2.0 1.2 0.9 1.0 2.5 3.6 3.8 2.9 2.3 1.7 1.0 2.7 2.1 1.9 1.9 4.3 3.0 3.3 2.9 2.2 2.2 1.4 1.0 2.2 2.2 2.1 2.2 1.9 2.2 1.7 1.4 1.7 2.1 1.9 1.9 1.5 1.9 1.4 1.2 1.9 1.9 2.2 1.4 1.7 3.9 2.1 2.2 0.8 2.3 2.2 2.3 0.3 2.6 2.8 2.4 0.1 0.2 0.2 2.9 2.7 2.2 0.1 3.4 7.5 8.4 8.2 8.3 5.2 3.0 3.0 2.5 1.6 3.3 7.4 7.7 7.8 8.2 5.4 2.9 2.8 2.9 2.9 10.5 12.8 2.6 2.6 2.9 3.8 3.3 2.9 2.8 3.0 8.3 8.8 3.5 1.1 1.3 1.8 1.9 2.0 2.1 1.6 4.1 4.1 2.6 1.9 1.3 1.0 2.5 2.1 1.7 2.0 1.8 2.4 2.1 1.6 1.3 2.7 2.4 1.8 2.2 2.8 2.5 2.2 1.9 1.4 2.5 2.5 1.8 2.7 2.4 2.2 2.2 1.5 2.4 2.7 2.4 3.4 2.2 2.5 2.0 1.3 2.7 2.5 1.9 2.4 2.3 1.8 1.6 1.7 2.1 1.9 1.4 2.1 2.5 2.3 2.0 1.7 1.4 1.1 2.2 2.4 2.4 1.7 1.2 0.9 0.9 2.5 2.4 2.0 1.2 0.9 0.8 0.8 0.9 2.2 2.4 1.9 1.1 0.8 0.7 0.7 0.8 1.2 2.1 1.6 1.1 0.8 0.8 0.8 0.8 0.7 1.2 1.2 1.0 1.0 1.0 0.9 0.9 0.8 0.6 0.7 0.7 0.9 1.4 1.7 1.5 1.3 1.0 0.9 1.3 1.0 0.7 0.8 1.8 2.4 2.3 2.0 1.3 1.0 2.1 1.6 0.9 0.6 1.1 2.0 2.1 2.3 1.8 2.0 1.5 2.1 1.9 1.1 0.6 0.7 2.9 2.5 2.1 1.3 1.8 1.7 3.4 1.9 1.9 1.1 0.6 0.4 2.7 2.3 1.5 1.8 6.3 2.2 2.3 1.7 0.9 0.5 2.3 2.4 1.8 1.2 1.3 3.5 2.1 2.0 1.6 2.0 2.4 2.5 1.8 1.1 0.6 0.4 2.7 2.3 1.6 1.9 4.7 1.9 2.7 1.7 5.1 2.0 2.5 1.9 1.2 0.7 0.5 2.1 2.4 2.0 5.5 10.1 1.4 2.4 2.3 1.7 2.1 3.1 2.0 2.1 1.3 0.7 0.5 0.3 2.0 2.2 1.3 7.0 9.0 1.0 1.9 2.2 2.2 3.9 1.9 1.3 1.2 1.9 1.9 1.9 1.6 0.9 0.5 0.3 2.2 2.1 1.2 7.4 11.1 0.7 1.3 2.0 1.9 1.9 1.7 0.8 0.8 1.0 0.8 0.6 0.5 1.6 3.0 2.2 2.0 1.7 1.1 1.5 1.9 1.8 1.5 0.9 0.6 0.3 1.9 1.6 1.0 0.6 7.3 6.5 1.0 0.6 0.6 0.6 0.8 1.3 1.8 2.2 3.1 2.0 2.4 2.3 2.4 2.0 1.9 2.0 1.3 0.9 0.9 1.0 0.9 0.8 0.5 0.4 0.9 0.9 0.6 0.5 2.8 1.8 0.7 0.5 0.5 0.8 1.6 1.9 2.4 2.2 1.9 2.3 2.0 1.7 1.7 1.8 1.6 1.3 0.8 0.6 0.4 0.5 0.4 0.4 0.3 0.5 0.4 0.4 0.3 1.3 1.0 1.4 1.1 0.8 0.6 0.5 0.8 1.6 2.4 2.1 1.9 1.9 1.8 1.6 1.2 1.0 0.9 0.9 0.8 0.7 0.5 0.3 0.2 0.2 0.2 0.3 0.3 0.3 0.3 1.1 0.9 0.7 2.0 2.0 1.2 0.7 0.5 2.2 2.5 1.9 1.3 1.2 1.0 0.8 0.7 0.5 0.5 0.4 0.4 0.3 0.2 0.2 0.1 0.2 0.2 2.0 1.6 1.6 1.7 1.4 1.1 1.9 1.9 2.2 1.9 2.5 2.0 2.4 1.6 1.0 0.7 0.6 0.5 0.4 0.3 0.3 0.2 1.9 1.5 1.7 2.1 2.0 2.0 1.7 1.3 2.0 2.2 2.1 2.1 2.5 2.4 1.9 1.2 0.8 0.5 0.4 0.3 1.6 2.5 1.7 2.1 1.4 0.9 1.4 1.2 1.4 1.2 1.8 2.0 1.7 1.3 0.9 0.6 0.4 0.3 1.7 1.3 1.0 1.4 1.9 2.0 2.4 2.1 1.8 1.1 1.3 1.3 1.1 0.9 0.7 0.5 1.5 1.9 1.8 1.7 2.0 1.3 2.1 1.8 2.1 1.6 1.0 0.8 0.7 0.6 2.2 1.9 1.4 0.6 0.3 2.0 2.1 2.1 0.8 0.7 0.4 0.2 0.1 0.4 1.4 1.2 1.5 1.6 3.7 1.7 2.1 1.4 0.9 0.9 1.7 2.1 1.3 0.7 2.0 1.7 1.0 1.6 1.1 0.4 0.7 0.9 0.8 0.6 0.3 0.4 0.5 0.5 0.2 0.3 0.3 0.3 0.5 0.4 0.3 1.1 0.7 1.9 1.9 1.2 2.0 2.2 3.1 2.0 2.3 2.5 1.7 2.2 0.8 1.2 1.4 0.8 1.0 0.9 11.2 10.3 9.8 11.9 10.9 10.3 12.1 10.7 10.4 12.0 10.4 10.2 12.2 4.4 5.5 5.5 5.5 6.1 5.9 5.8 6.2 5.9 5.8 6.2 6.3 8.2 9.0 9.2 9.4 7.2 7.9 5.0 5.7 7.3 7.5 6.1 6.9 5.8 6.9 7.5 8.1 5.3 5.9 8.0 5.4 7.0 5.1 8.4 12.6 6.6 8.5 6.4 9.0 12.0 7.7 9.1 8.1 10.5 11.4 3.7 5.7 7.3 11.7 PX1 PX1 PX2 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1BX1 BX1 BX1 XP1 1 PX1 PX1 PX1 PX1 PX2 DX2 BX2 BX2 BX2 BX2 BX2 DX2 DX2 DX2 BX2 BX2 BX2 BX2 DX2 DX2 BX2 DX2 BX2 BX2 DX2 BX2 BX2 BX2 DX2 DX2DX2 DX1 DX1 DX1 DX1 DX2 DX2 DX2 NX1 NX1 NX1 NX1 NX1 DX2 DX2 DX2 DX2 DX2DX2 NX1 NX1 DX2 DX1 DX1 DX1 DX2 DX2 DX2 DX2 DX2 NX1 NX1 BX1 BX1 FX1 FX1 HGA NO: DATE: NO DESCRIPTION DATE CITY OF RICHFIELD WOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC. ISSUANCE HISTORY - THIS SHEET LAND USE SUBMITTAL DECEMBER 16, 2024 0969-005-00 KEYPLAN AREA A AREA B AREA D AREA C 6710 LAKE SHORE DR S RICHFIELD, MN 55423 1/9/2025 7:41:57 PM C:\Users\eeameliar\Documents\Revit Local Files\E24_Wood Lake Nature Center_0969-005-00_arosenbush.rvtE032 LIGHTING PHOTOMETRICS Author1" = 30'-0"1 LIGHTING SITE PLAN - PHOTOMETRIC