Loading...
2025-02-11 City Council AgendaREGULAR CITY COUNCIL MEETING RICHFIELD MUNICIPAL CENTER, COUNCIL CHAMBERS FEBRUARY 11, 2025 7:00 PM INTRODUCTORY PROCEEDINGS Call to order Pledge of Allegiance Open forum Participants can share their comments in person, by voicemail, or email, and may also request to participate virtually. For more information on submitting comments, refer to the Council Agenda and Minutes page on richfieldmn.gov/citycouncil Approval of the Minutes of the (1) City Council Work Session Meeting from January 28, 2025, and (2) City Council Regular Meeting from January 28, 2025. PRESENTATIONS 1.Proclamation Celebrating Black History Month AGENDA APPROVAL 2.Approval of the Agenda 3.Consent Calendar contains several separate items, which are acted upon by the City Council in one motion. Once the Consent Calendar has been approved, the individual items and recommended actions have also been approved. No further Council action on these items is necessary. However, any Council Member may request that an item be removed from the Consent Calendar and placed on the regular agenda for Council discussion and action. All items listed on the Consent Calendar are recommended for approval. A.Consider the approval of a second reading of an ordinance amendment pertaining to City Code Section 925.01 - Public Nuisances Subd. 2. The City Council approved the first reading on January 28, 2025. Staff Report No. 22 B.Consider a resolution authorizing the designation of $1,000,000 in City of Richfield Capital Reserve Funds to serve as assurance of funding for the Wood Lake Nature Center Building Project, for the purposes of releasing funds from the 2023 State of Minnesota Appropriations Bill, administered by the MN Department of Employment and Economic Development, in the amount of $12,000,000. Staff Report No. 23 C.Consider the approval of the first amendment to the Foundational Public Health Responsibilities (FPHR) agreement with the City of Bloomington. Staff Report No. 24 D.Consider approval of a fifth amendment to the agreement with the City of Bloomington for the provision of public health services for the City of Richfield for 2025. Staff Report No. 25 4.Consideration of items, if any, removed from Consent Calendar RESOLUTIONS 5.Consider a request for site plan approval of an entirely new Wood Lake Nature Center building at 6710 Lake Shore Drive. Staff Report No. 26 OTHER BUSINESS 6.M. A. Mortenson Construction proposed Guaranteed Maximum Price for construction of Wood Lake Nature Center. Staff Report No. 27 CITY MANAGER’S REPORT 7.City Manager's Report CLAIMS AND PAYROLLS 8.Claims and Payroll COUNCIL DISCUSSION 9.Hats Off to Hometown Hits 10.Adjournment Auxiliary aids for individuals with disabilities are available upon request. Requests must be made at least 96 hours in advance to the City Clerk at 612-861-9739. CITY COUNCIL MEETING MINUTES Richfield, Minnesota City Council Work Session January 28, 2025 CALL TO ORDER Mayor Supple called the work session to order at 6:00 p.m. in the Bartholomew Room. Councilmembers Present: Mary Supple, Mayor; Sharon Christensen; Walter Burk, Sean Hayford Oleary, Rori A. Coleman-Woods Staff Present: Guests: Katie Rodriguez, City Manager; Samantha Crosby, Community Development Planner; Melissa Poehlman, Community Development Director; Michelle Friedrich, City Clerk; and Courtney Miller, Senior Analyst ITEM #1 DISCUSS BAN ON SHORT-TERM RENTALS City Manager Rodriguez provided an overview of the agenda and introduced the first item, turning it over to City Planner Crosby. City Planner Crosby introduced the topic to the Council, and discussed the solutions for the issue and noted the staff recommendation for the topic. Mayor Supple highlighted residents' concerns regarding short-term rentals, emphasizing issues related to "party houses" and related complaints. Councilmember Christensen asked how many short-term rentals exist in the City. City Planner Crosby explained 72 rental properties exist, but are were self-reported so the number may not be completely accurate. Councilmember Hayford Oleary asked if Mayor Supple still thought this was a big concern after staff shared their findings. Mayor Supple responded short-term rentals had not been a concern until neighboring communities began banning short-term rentals. Mayor Supple noted she does not object to owner-occupied rentals, she is leaning toward a ban on short-term rentals due to enforcement challenges. City Council Work Session Minutes -2- January 28, 2025 Councilmember Hayford Oleary shared feedback from local business owners, noting that if the staff supports it, a one-week rental limit could be implemented. Councilmember Christensen inquired on total number of emergency calls received from rentals. Community Development Director Poehlman noted it is difficult to crossmatch the calls received, but staff could look into it. Mayor Supple expressed her preference for banning rentals shorter than 30 days, though she could accept a two-week limit. City Planner Crosby noted a consensus for some form of limitation and suggested that the next step would be gathering community feedback. Council Member Hayford Oleary added that there seems to be agreement to delay enforcement until January 1, 2026. Mayor Supple inquired about who would receive notices. City Planner Crosby welcomed feedback on the recipients of such notices. Community Development Director Poehlman recommended sending notices to all rental owners to ensure broad awareness and stated no additional work session would be necessary unless the Council requests one. ADJOURNMENT Mayor Supple adjourned the work session at 6:27 pm. Date Approved: February 11, 2025 Mary B. Supple Mayor Michelle Friedrich Katie Rodriguez City Clerk City Manager CITY COUNCIL MEETING MINUTES Richfield, Minnesota City Council Work Session January 28, 2025 CALL TO ORDER Mayor Supple called the work session to order at 6:00 p.m. in the Bartholomew Room. Councilmembers Present: Mary Supple, Mayor; Sharon Christensen; Walter Burk, Sean Hayford Oleary, Rori A. Coleman-Woods Staff Present: Guests: Katie Rodriguez, City Manager; Samantha Crosby, Community Development Planner; Melissa Poehlman, Community Development Director; Michelle Friedrich, City Clerk; and Courtney Miller, Senior Analyst ITEM #1 DISCUSS BAN ON SHORT-TERM RENTALS City Manager Rodriguez provided an overview of the agenda and introduced the first item, turning it over to City Planner Crosby. City Planner Crosby introduced the topic to the Council, and discussed the solutions for the issue and noted the staff recommendation for the topic. Mayor Supple highlighted residents' concerns regarding short-term rentals, emphasizing issues related to "party houses" and related complaints. Councilmember Christensen asked how many short-term rentals exist in the City. City Planner Crosby explained 72 rental properties exist, but are were self-reported so the number may not be completely accurate. Councilmember Hayford Oleary asked if Mayor Supple still thought this was a big concern after staff shared their findings. Mayor Supple responded short-term rentals had not been a concern until neighboring communities began banning short-term rentals. Mayor Supple noted she does not object to owner-occupied rentals, she is leaning toward a ban on short-term rentals due to enforcement challenges. REVISION City Council Work Session Minutes -2-January 28, 2025 Councilmember Hayford Oleary shared feedback from local business owners, noting that if the staff supports it, a one-week rental limit could be implemented. Councilmember Burk inquired on total number of emergency calls received from rentals. Community Development Director Poehlman noted it is difficult to crossmatch the calls received, but staff could look into it. Mayor Supple expressed her preference for banning rentals shorter than 30 days, though she could accept a two-week limit. City Planner Crosby noted a consensus for some form of limitation and suggested that the next step would be gathering community feedback. Council Member Hayford Oleary added that there seems to be agreement to delay enforcement until January 1, 2026. Mayor Supple inquired about who would receive notices. City Planner Crosby welcomed feedback on the recipients of such notices. Community Development Director Poehlman recommended sending notices to all rental owners to ensure broad awareness and stated no additional work session would be necessary unless the Council requests one. ADJOURNMENT Mayor Supple adjourned the work session at 6:27 pm. Date Approved: February 11, 2025 Mary B. Supple Mayor Michelle Friedrich Katie Rodriguez City Clerk City Manager REVISION CALL TO ORDER The meeting was called to order by Mayor Supple at 7:00 p.m. in the Council Chambers. Councilmembers Present: Mary Supple, Mayor; Sharon Christensen; Walter Burk; Sean Hayford Oleary; and Rori A. Coleman-Woods. Staff Present: Katie Rodriguez, City Manager; Mary Tietjen, City Attorney; Melissa Pohlman, Community Development Director, Kristin Asher, Public Works Director; Public Safety Support Services Manager Jennifer Anderson; and Michelle Friedrich, City Clerk. Others Present: PLEDGE OF ALLEGIANCE Mayor Supple led the Pledge of Allegiance. OPEN FORUM Mayor Supple reviewed the participation options for residents at the Council meeting including in- person comments, comments by voicemail or email, and an option to request to participate virtually with advance notice. Mayor Supple noted more information on submitting comments can be reviewed at www.richfieldmn.gov/citycouncil. Scott Dahlquist, 6913 11th Ave South, discussed issues related to the Concierge living situation. He noted the legal processes and protocols were followed correctly, but opined the situation was not just. Mr. Dahlquist requested the Council approve a Memorandum of Understanding supporting a request for financial assistance for the 4d tax status. Kathleen Balaban, 6526 Stevens Avenue South, requested Council and the Charter Commission to collaborate on updates and review their responsibilities as set forth in the City Code and Charter. Ms. Balaban opined on the Charter Commission meeting length, Charter Commission bylaws, and administrative code updates. Rodney Sather, 6321 Thomas Avenue South, complimented the Council and staff for their work in the earlier Work Session meeting regarding information presented on short-term rental units.. CITY COUNCIL MEETING MINUTES Richfield, Minnesota Regular Council Meeting January 28, 2025 City Council Meeting Minutes -2- January 28, 2025 Melissa Melnick Gonzalez, Oak Grove Lutheran Church Pastor, noted her support for the 4d tax classification for Hempel Real Estate. She added the importance of keeping and maintaining affordable housing in Richfield. David Snyder, 513 70th Street West, noted his support for negotiating/granting 4d tax status regarding Hempel Real Estate and the three properties. Margaret Perez, 7228 Girard Avenue South, commented on the turnover and challenges families face in obtaining affordable housing. Ms. Krez opined on the preservation of affordable housing, utilizing Richfield’s existing, affordable housing, and supports the 4d tax status to the Hempel Real Estate properties. APPROVAL OF MINUTES MOTION: made by Councilmember Christensen, seconded by Councilmember Burk to approve the minutes of the: (1) City Council Special Meeting from January 7, 2025, (2) City Council Work Session Meeting from January 7, 2025, (3) City Council Work Session Meeting from January 14, 2025, (4) City Council Regular Meeting from January 14, 2025. Motion carried: 5-0 ITEM #1 CONGRESSWOMAN OMAR BRIEFING Mayor Supple invited Congresswoman Omar to give the Council a briefing. Congresswoman Omar congratulated Council Members Coleman-Woods and Burk for their election win. Congresswoman Omar shared the activities her office has participated with in Richfield over the past year and updated Council on the issues Congress is prioritizing. Councilmember Hayford Oleary noted he appreciates Congresswoman Omar’s presence in Richfield and her involvement in community events and issues. Councilmember Coleman-Woods thanked Congresswoman Omar for her attendance. ITEM #2 APPROVAL OF THE AGENDA MOTION: made by Councilmember Hayford Oleary, seconded by Councilmember Coleman-Woods to approve the Agenda as presented. Motion carried: 5-0 ITEM #3 CONSENT CALENDAR City Manager Rodriguez presented the consent calendar. City Council Meeting Minutes -3- January 28, 2025 A. Consider the approval of a first reading of an ordinance amendment pertaining to City Code Section 925.01 - Public Nuisances Subd. 2.(Staff Report No. 15) B. Consider authorizing the purchase of two Olympia Millenium E ice resurfacers for $250,000 in budget year 2025 and $89,626 in budget year 2026, totaling $339,626, from CTM Services, Inc., and authorize the City Manager to approve contract changes up to $175,000 without further City Council consideration (Staff Report No. 16) C. Consider authorizing the purchase of a Pierce Enforcer PUC Fire Pumper for $400,000.00 in budget year 2025 and $302,095.67 in budget years 2026, 2027, and 2028, totaling $1,306,287.00, from MacQueen Emergency Group, and authorizing the City Manager to approve contract changes up to $175,000.00 without further City Council consideration. (Staff Report No. 17) MOTION: made by Councilmember Hayford Oleary, seconded by Council Member Christensen to approve the consent calendar items 3A-C. Motion carried: 5-0 ITEM #4 CONSIDERATION OF ITEMS, IF ANY, REMOVED FROM CONSENT CALENDAR None. ITEM #5 CONSIDER A SECOND READING AND SUMMARY PUBLICATION OF AN ORDINANCE AMENDMENT REGARDING DRIVE-THROUGH SIGNS (STAFF REPORT NO. 18) Councilmember Burk presented the second reading of ordinance amendment regarding drive- through signs. Councilmember Hayford Oleary noted he was happy with where the discussion landed. He discussed the lack of clarity over if you have a menu board sign and you later would like to add a freestanding sign, would that be prohibited? Community Development Director Poehlman noted that there are specifications regarding his question in the full ordinance. MOTION: made by Councilmember Burk, seconded by Councilmember Hayford Oleary to approve the second reading of an ordinance amending the Richfield Zoning Code regulations related to drive-through signs and adopt resolution approving summary publication. BILL NO. 2025-02 AN ORDINANCE AMENDING THE RICHFIELD ZONING CODE REGULATIONS RELATED TO DRIVE-THROUGH SIGNS RESOLUTION NO. 12297 RESOLUTION APPROVING SUMMARY PUBLICATION OF AN ORDINANCE REGARDING DRIVE-THROUGH SIGNS City Council Meeting Minutes -4- January 28, 2025 Motion carried: 5-0 ITEM #6 CONSIDERATION OF A RESOLUTION SUPPORTING A 4D TAX CLASSIFICATION FOR HEMPEL REAL ESTATE RELATING TO THE ACQUISITION AND PRESERVATION OF THREE AFFORDABLE RENTAL COMMUNITIES (STAFF REPORT NO. 19) Councilmember Coleman-Woods presented a resolution supporting a 4d tax classification for Hempel Real Estate relating to the acquisition and preservation of three affordable rental communities. Councilmember Hayford Oleary noted the tax burden shift is tough to accept, but the immediate benefit is worth it. Councilmember Burk added his support for the 4D tax classification. Councilmember Coleman-Woods noted the tax burden may be heavy for some, but she does support the decision. Councilmember Christensen discussed her support for the 4d tax classification. Mayor Supple added that she believes that the benefits outweigh the trade-offs. She noted that this is not setting a precedent. MOTION: made by Councilmember Coleman-Woods, seconded by Hayford Oleary to adopt a resolution supporting a 4d tax classification for Hemple Real Estate relating to the acquisition and preservation of three affordable rental communities. RESOLUTION NO. 12298 RESOLUTION AUTHORIZING THE USE OF 4d TAX CLASSIFICATION FOR RENTAL PROPERTIES LOCATED AT 50 WEST 78TH STREET, 1300-1324 EAST 78TH STREET AND 7500-7544 CEDAR AVENUE BY HEMPEL HOLDINGS, LLC, OR A SUBSIDIARY THEREOF Motion carried: 5-0 ITEM #7 VIOLATION HEARING AND CONSIDER A RESOLUTION REGARDING CIVIL ENFORCEMENT FOR ESTABLISHMENTS THAT RECENTLY UNDERWENT ALCOHOL COMPLIANCE CHECKS CONDUCTED BY RICHFIELD PUBLIC SAFETY STAFF, AND FAILED BY SELLING ALCOHOL TO A PERSON UNDER THE AGE OF 21. (STAFF REPORT NO. 20) Councilmember Hayford Oleary noted the violation hearing and instructed representatives from each business of the hearing process. Councilmember Hayford Oleary presented three resolutions at the violation hearing regarding civil enforcement for alcohol compliance check failures on November 14, 2024, by public safety staff, for three separate establishments, and noted penalties and fines imposed for first-time alcohol compliance failure. City Council Meeting Minutes -5- January 28, 2025 A representative from Joy’s Pattaya Thai was absent from the meeting. Public Safety Support Services Manager Anderson noted Joy’s Pattaya Thai was contacted regarding the failed compliance check and was invited to attend the meeting tonight, if they wished to contest the failed compliance check. Based on Joy’s Pattaya Thai’s acceptance of non-compliance in communication with Public Safety staff, City Attorney Tietjen recommended Council adopt the resolution for Joy’s Pattaya Thai suspending their liquor license and imposing a first-time alcohol compliance failure. A representative from Davanni’s Inc., confirmed the non-compliance allegation and accepted the penalties. Joe Spencer, District Manager from My Burger Inc., confirmed the non-compliance allegation and accepted the penalties. MOTION: made by Councilmember Hayford Oleary, seconded by Council Member Coleman-Woods to adopt a resolution suspending the liquor license for Joy’s Pattaya Thai restaurant, LLC Joy’s Pattaya Thai d/b/a, 7545 Lyndale Avenue South, and imposing a civil penalty for first-time alcohol compliance failure. RESOLUTION NO.12299 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR JOY’S PATTAYA THAI RESTAURANT, LLC d/b/a JOY’S PATTAYA THAI, 7545 LYNDALE AVENUE SOUTH AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE Motion carried: 5-0 MOTION: made by Council member Hayford Oleary, seconded by Councilmember Coleman-Woods to adopt a resolution suspending the liquor license for Davanni’s Inc. Davanni’s Pizza and Hot Hoagie’s d/b/a, 6345 Penn Avenue South and imposing a civil penalty for first-time alcohol compliance failure. RESOLUTION NO. 12300 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR DAVANNI’S INC. d/b/a DAVANNI’S PIZZA AND HOT HOAGIE’S, 6345 PENN AVENUE SOUTH AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE Motion carried: 5-0 MOTION: made by Councilmember Hayford Oleary, seconded by Councilmember Coleman-Woods to adopt a resolution suspending the liquor license for My Burger Operations, LLC d/b/a My Burger, 6555 Lyndale Avenue South and imposing a civil penalty for first-time alcohol compliance failure. RESOLUTION NO. 12301 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR MY BURGER OPERATIONS, LLC d/b/a MY BURGER, 6555 LYNDALE AVENUE SOUTH AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE Motion carried: 5-0 ITEM #8 CONSIDER APPOINTMENT TO FILL A VACANCY ON THE SUSTAINABILITY COMMISSION (STAFF REPORT NO. 21) City Council Meeting Minutes -6- January 28, 2025 Council Member Christensen presented the staff report for consideration to fill a vacant position on the Sustainability Commission. MOTION: made by Councilmember Christensen, seconded by Councilmember Hayford Oleary to appoint Alexa Wozniak to fill the vacancy on the Sustainability Commission commencing on January 28, 2025 and expiring January 31, 2026. Motion carried: 5-0 ITEM #9 CITY MANAGER’S REPORT City Manager Rodriguez shared information regarding additional information about the recent order from the Trump administration pausing grants and loans, and impacts to potential local funding. ITEM #10 CLAIMS AND PAYROLL MOTION: made by Councilmember Hayford Oleary, seconded by Councilmember Christensen to approve the following claims and payrolls: U.S. BANK 01/17/2025 Payroll: 193949 – 194269; 44121-44124* manual checks $ 1,214,496.77 U.S. BANK 01/24/2025 A/P Checks: 334005 – 334310 (12/31/24-1/23/25) $ 999,126.58 TOTAL $ 2,213,623.35 Motion carried: 5-0 ITEM #11 HATS OFF TO HOMETOWN HITS Councilmember Coleman-Woods noted she has nothing to share. Councilmember Christensen noted the Woodlake Nature Center staff, for keeping up with the different camps throughout construction. She urged families to sign up their kids for the camps. Councilmember Hayford Oleary thanked the residents of Lake Side Condos for their collaboration with him. Councilmember Burk noted he has nothing to share. Mayor Supple expressed appreciation to the many volunteers at the farewell event held at the Wood Lake Nature Center. Mayor Supple recognized Tynika Smith for her volunteer work with organizing donations and helping provide food, blankets, and warm clothing to people who were unsheltered. City Council Meeting Minutes -7- January 28, 2025 ITEM #12 ADJOURNMENT MOTION: made by Councilmember Hayford Oleary, seconded by Council Member Burk to adjourn the meeting at 8:13 p.m. Motion carried: 5-0 Date Approved: February 11, 2025 Mary Supple Mayor Michelle Friedrich Katie Rodriguez City Clerk City Manager CALL TO ORDER The meeting was called to order by Mayor Supple at 7:00 p.m. in the Council Chambers. Councilmembers Present: Mary Supple, Mayor; Sharon Christensen; Walter Burk; Sean Hayford Oleary; and Rori A. Coleman-Woods. Staff Present: Katie Rodriguez, City Manager; Mary Tietjen, City Attorney; Melissa Pohlman, Community Development Director, Kristin Asher, Public Works Director; Public Safety Support Services Manager Jennifer Anderson; and Michelle Friedrich, City Clerk. Others Present: PLEDGE OF ALLEGIANCE Mayor Supple led the Pledge of Allegiance. OPEN FORUM Mayor Supple reviewed the participation options for residents at the Council meeting including in- person comments, comments by voicemail or email, and an option to request to participate virtually with advance notice. Mayor Supple noted more information on submitting comments can be reviewed at www.richfieldmn.gov/citycouncil. Scott Dahlquist, 6913 11th Ave South, discussed issues related to the Concierge living situation. He noted the legal processes and protocols were followed correctly, but opined the situation was not just. Mr. Dahlquist requested the Council approve a Memorandum of Understanding supporting a request for financial assistance for the 4d tax status. Kathleen Balaban, 6526 Stevens Avenue South, requested Council and the Charter Commission to collaborate on updates and review their responsibilities as set forth in the City Code and Charter. Ms. Balaban opined on the Charter Commission meeting length, Charter Commission bylaws, and administrative code updates. Rodney Sather, 6321 Thomas Avenue South, complimented the Council and staff for their work in the earlier Work Session meeting regarding information presented on short-term rental units.. CITY COUNCIL MEETING MINUTES Richfield, Minnesota Regular Council Meeting January 28, 2025 REVISION City Council Meeting Minutes -2-January 28, 2025 Melissa Melnick Gonzalez, Oak Grove Lutheran Church Pastor, noted her support for the 4d tax classification for Hempel Real Estate. She added the importance of keeping and maintaining affordable housing in Richfield. David Snyder, 513 70th Street West, noted his support for negotiating/granting 4d tax status regarding Hempel Real Estate and the three properties. Margaret Perez, 7228 Girard Avenue South, commented on the turnover and challenges families face in obtaining affordable housing. Ms. Perez opined on the preservation of affordable housing, utilizing Richfield’s existing, affordable housing, and supports the 4d tax status to the Hempel Real Estate properties. APPROVAL OF MINUTES MOTION: made by Councilmember Christensen, seconded by Councilmember Burk to approve the minutes of the: (1) City Council Special Meeting from January 7, 2025, (2) City Council Work Session Meeting from January 7, 2025, (3) City Council Work Session Meeting from January 14, 2025, (4) City Council Regular Meeting from January 14, 2025. Motion carried: 5-0 ITEM #1 CONGRESSWOMAN OMAR BRIEFING Mayor Supple invited Congresswoman Omar to give the Council a briefing. Congresswoman Omar congratulated Council Members Coleman-Woods and Burk for their election win. Congresswoman Omar shared the activities her office has participated with in Richfield over the past year and updated Council on the issues Congress is prioritizing. Councilmember Hayford Oleary noted he appreciates Congresswoman Omar’s presence in Richfield and her involvement in community events and issues. Councilmember Coleman-Woods thanked Congresswoman Omar for her attendance. ITEM #2 APPROVAL OF THE AGENDA MOTION: made by Councilmember Hayford Oleary, seconded by Councilmember Coleman-Woods to approve the Agenda as presented. Motion carried: 5-0 ITEM #3 CONSENT CALENDAR City Manager Rodriguez presented the consent calendar. REVISION City Council Meeting Minutes -3- January 28, 2025 A. Consider the approval of a first reading of an ordinance amendment pertaining to City Code Section 925.01 - Public Nuisances Subd. 2.(Staff Report No. 15) B. Consider authorizing the purchase of two Olympia Millenium E ice resurfacers for $250,000 in budget year 2025 and $89,626 in budget year 2026, totaling $339,626, from CTM Services, Inc., and authorize the City Manager to approve contract changes up to $175,000 without further City Council consideration (Staff Report No. 16) C. Consider authorizing the purchase of a Pierce Enforcer PUC Fire Pumper for $400,000.00 in budget year 2025 and $302,095.67 in budget years 2026, 2027, and 2028, totaling $1,306,287.00, from MacQueen Emergency Group, and authorizing the City Manager to approve contract changes up to $175,000.00 without further City Council consideration. (Staff Report No. 17) MOTION: made by Councilmember Hayford Oleary, seconded by Council Member Christensen to approve the consent calendar items 3A-C. Motion carried: 5-0 ITEM #4 CONSIDERATION OF ITEMS, IF ANY, REMOVED FROM CONSENT CALENDAR None. ITEM #5 CONSIDER A SECOND READING AND SUMMARY PUBLICATION OF AN ORDINANCE AMENDMENT REGARDING DRIVE-THROUGH SIGNS (STAFF REPORT NO. 18) Councilmember Burk presented the second reading of ordinance amendment regarding drive- through signs. Councilmember Hayford Oleary noted he was happy with where the discussion landed. He discussed the lack of clarity over if you have a menu board sign and you later would like to add a freestanding sign, would that be prohibited? Community Development Director Poehlman noted that there are specifications regarding his question in the full ordinance. MOTION: made by Councilmember Burk, seconded by Councilmember Hayford Oleary to approve the second reading of an ordinance amending the Richfield Zoning Code regulations related to drive-through signs and adopt resolution approving summary publication. BILL NO. 2025-02 AN ORDINANCE AMENDING THE RICHFIELD ZONING CODE REGULATIONS RELATED TO DRIVE-THROUGH SIGNS RESOLUTION NO. 12297 RESOLUTION APPROVING SUMMARY PUBLICATION OF AN ORDINANCE REGARDING DRIVE-THROUGH SIGNS City Council Meeting Minutes -4- January 28, 2025 Motion carried: 5-0 ITEM #6 CONSIDERATION OF A RESOLUTION SUPPORTING A 4D TAX CLASSIFICATION FOR HEMPEL REAL ESTATE RELATING TO THE ACQUISITION AND PRESERVATION OF THREE AFFORDABLE RENTAL COMMUNITIES (STAFF REPORT NO. 19) Councilmember Coleman-Woods presented a resolution supporting a 4d tax classification for Hempel Real Estate relating to the acquisition and preservation of three affordable rental communities. Councilmember Hayford Oleary noted the tax burden shift is tough to accept, but the immediate benefit is worth it. Councilmember Burk added his support for the 4D tax classification. Councilmember Coleman-Woods noted the tax burden may be heavy for some, but she does support the decision. Councilmember Christensen discussed her support for the 4d tax classification. Mayor Supple added that she believes that the benefits outweigh the trade-offs. She noted that this is not setting a precedent. MOTION: made by Councilmember Coleman-Woods, seconded by Hayford Oleary to adopt a resolution supporting a 4d tax classification for Hemple Real Estate relating to the acquisition and preservation of three affordable rental communities. RESOLUTION NO. 12298 RESOLUTION AUTHORIZING THE USE OF 4d TAX CLASSIFICATION FOR RENTAL PROPERTIES LOCATED AT 50 WEST 78TH STREET, 1300-1324 EAST 78TH STREET AND 7500-7544 CEDAR AVENUE BY HEMPEL HOLDINGS, LLC, OR A SUBSIDIARY THEREOF Motion carried: 5-0 ITEM #7 VIOLATION HEARING AND CONSIDER A RESOLUTION REGARDING CIVIL ENFORCEMENT FOR ESTABLISHMENTS THAT RECENTLY UNDERWENT ALCOHOL COMPLIANCE CHECKS CONDUCTED BY RICHFIELD PUBLIC SAFETY STAFF, AND FAILED BY SELLING ALCOHOL TO A PERSON UNDER THE AGE OF 21. (STAFF REPORT NO. 20) Councilmember Hayford Oleary noted the violation hearing and instructed representatives from each business of the hearing process. Councilmember Hayford Oleary presented three resolutions at the violation hearing regarding civil enforcement for alcohol compliance check failures on November 14, 2024, by public safety staff, for three separate establishments, and noted penalties and fines imposed for first-time alcohol compliance failure. City Council Meeting Minutes -5- January 28, 2025 A representative from Joy’s Pattaya Thai was absent from the meeting. Public Safety Support Services Manager Anderson noted Joy’s Pattaya Thai was contacted regarding the failed compliance check and was invited to attend the meeting tonight, if they wished to contest the failed compliance check. Based on Joy’s Pattaya Thai’s acceptance of non-compliance in communication with Public Safety staff, City Attorney Tietjen recommended Council adopt the resolution for Joy’s Pattaya Thai suspending their liquor license and imposing a first-time alcohol compliance failure. A representative from Davanni’s Inc., confirmed the non-compliance allegation and accepted the penalties. Joe Spencer, District Manager from My Burger Inc., confirmed the non-compliance allegation and accepted the penalties. MOTION: made by Councilmember Hayford Oleary, seconded by Council Member Coleman-Woods to adopt a resolution suspending the liquor license for Joy’s Pattaya Thai restaurant, LLC Joy’s Pattaya Thai d/b/a, 7545 Lyndale Avenue South, and imposing a civil penalty for first-time alcohol compliance failure. RESOLUTION NO.12299 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR JOY’S PATTAYA THAI RESTAURANT, LLC d/b/a JOY’S PATTAYA THAI, 7545 LYNDALE AVENUE SOUTH AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE Motion carried: 5-0 MOTION: made by Council member Hayford Oleary, seconded by Councilmember Coleman-Woods to adopt a resolution suspending the liquor license for Davanni’s Inc. Davanni’s Pizza and Hot Hoagie’s d/b/a, 6345 Penn Avenue South and imposing a civil penalty for first-time alcohol compliance failure. RESOLUTION NO. 12300 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR DAVANNI’S INC. d/b/a DAVANNI’S PIZZA AND HOT HOAGIE’S, 6345 PENN AVENUE SOUTH AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE Motion carried: 5-0 MOTION: made by Councilmember Hayford Oleary, seconded by Councilmember Coleman-Woods to adopt a resolution suspending the liquor license for My Burger Operations, LLC d/b/a My Burger, 6555 Lyndale Avenue South and imposing a civil penalty for first-time alcohol compliance failure. RESOLUTION NO. 12301 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR MY BURGER OPERATIONS, LLC d/b/a MY BURGER, 6555 LYNDALE AVENUE SOUTH AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE Motion carried: 5-0 ITEM #8 CONSIDER APPOINTMENT TO FILL A VACANCY ON THE SUSTAINABILITY COMMISSION (STAFF REPORT NO. 21) City Council Meeting Minutes -6- January 28, 2025 Council Member Christensen presented the staff report for consideration to fill a vacant position on the Sustainability Commission. MOTION: made by Councilmember Christensen, seconded by Councilmember Hayford Oleary to appoint Alexa Wozniak to fill the vacancy on the Sustainability Commission commencing on January 28, 2025 and expiring January 31, 2026. Motion carried: 5-0 ITEM #9 CITY MANAGER’S REPORT City Manager Rodriguez shared information regarding additional information about the recent order from the Trump administration pausing grants and loans, and impacts to potential local funding. ITEM #10 CLAIMS AND PAYROLL MOTION: made by Councilmember Hayford Oleary, seconded by Councilmember Christensen to approve the following claims and payrolls: U.S. BANK 01/17/2025 Payroll: 193949 – 194269; 44121-44124* manual checks $ 1,214,496.77 U.S. BANK 01/24/2025 A/P Checks: 334005 – 334310 (12/31/24-1/23/25) $ 999,126.58 TOTAL $ 2,213,623.35 Motion carried: 5-0 ITEM #11 HATS OFF TO HOMETOWN HITS Councilmember Coleman-Woods noted she has nothing to share. Councilmember Christensen noted the Woodlake Nature Center staff, for keeping up with the different camps throughout construction. She urged families to sign up their kids for the camps. Councilmember Hayford Oleary thanked the residents of Lake Side Condos for their collaboration with him. Councilmember Burk noted he has nothing to share. Mayor Supple expressed appreciation to the many volunteers at the farewell event held at the Wood Lake Nature Center. Mayor Supple recognized Tynika Smith for her volunteer work with organizing donations and helping provide food, blankets, and warm clothing to people who were unsheltered. City Council Meeting Minutes -7- January 28, 2025 ITEM #12 ADJOURNMENT MOTION: made by Councilmember Hayford Oleary, seconded by Council Member Burk to adjourn the meeting at 8:13 p.m. Motion carried: 5-0 Date Approved: February 11, 2025 Mary Supple Mayor Michelle Friedrich Katie Rodriguez City Clerk City Manager Proclamation of the City of Richfield WHEREAS, Each February, during Black History Month, the United States honor the contributions and sacrifices of African Americans who have helped shape the nation; and WHEREAS, the City of Richfield, Minnesota also takes pride in recognizing February 2025 as Black History Month. We want to honor the many notable contributions that people of African descent have made to the United States, including our community, and celebrate the rich cultural heritage, triumphs and adversities that are an indelible part of our country’s history; and WHEREAS, we celebrate the diversity of Black people in Richfield, the State of Minnesota, our nation and the Black diaspora, whether they self-identify as African, African American, Afro-Latino, Afro-Caribbean, or Black; and WHEREAS, in January of 2025, the City of Richfield swore in the first Black Female Councilmember, Rori Coleman-Woods; and WHEREAS, Americans of African descent are responsible for more than 50,000 inventions with the US Patent Office that are used every day that improve the lives of Americans, such as home security systems, traffic lights, refrigerated trucks, and color monitors; and WHEREAS, the City of Richfield, its City Council and staff identify diversity and equity as core values, recognizing that our diverse culture is one of our greatest strengths and assets, striving to promote an environment of equity and inclusion; and WHEREAS, the Richfield Human Rights Commission supported this proclamation at its February 4, 2025 meeting and recommended the Richfield City Council do the same; and Now, THEREFORE, I, Mary Supple, mayor of Richfield, on behalf of the Richfield City Council, do hereby proclaim the month of February 2025 as Black History Month in the City of Richfield and call on the people of Richfield to observe this month with appropriate programs, activities, and ceremonies, and to continue to honor the contributions of Black Americans throughout the year. PROCLAIMED this 11th day of February, 2025. Mary Supple, Mayor AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #3.A. STAFF REPORT NO. 22 CITY COUNCIL MEETING 2/11/2025 REPORT PREPARED BY:Jennifer Anderson, Support Services Manager DEPARTMENT DIRECTOR REVIEW:Jay Henthorne, Director of Public Safety/Chief of Police OTHER DEPARTMENT REVIEW: CITY MANAGER REVIEW: Katie Rodriguez, City Manager 2/5/2025 ITEM FOR COUNCIL CONSIDERATION: Consider the approval of a second reading of an ordinance amendment pertaining to City Code Section 925.01 - Public Nuisances Subd. 2. The City Council approved the first reading on January 28, 2025. EXECUTIVE SUMMARY: In October 2023, the City Council approved an ordinance relating to managed natural landscapes and a new maintenance standard of grass height from 6" to 8" per state law. City Code Section 925.01 Subd.2 (g) also refers to the 6" maximum grass height. This section of code was overlooked in the initial passing of the ordinance change and needs to be updated to reflect current state statute. RECOMMENDED ACTION: By motion: Approve the second reading of an amendment to City Code section 925.01 Subd. 2(g) changing the grass height from 6" to 8" to comply with State law. BASIS OF RECOMMENDATION: A.HISTORICAL CONTEXT In October 2023, the City Council approved an ordinance relating to managed natural landscapes and a new maintenance standard of grass height from 6" to 8" per state law. City Code Section 925.01 Subd.2 (g) also refers to the 6" maximum grass height. This section was overlooked in the initial passing of the ordinance change. B.EQUITABLE OR STRATEGIC CONSIDERATIONS OR IMPACTS The Richfield Police Department is committed to ensuring equity and inclusivity in our work. In some instances, equity considerations may not directly apply; however, staff preparation and review of reports will always consider DEI principles. C.POLICIES (resolutions, ordinances, regulations, statutes, exc): Chapter 9 addresses public nuisances and maximum grass height for properties. D.CRITICAL TIMING ISSUES: None E.FINANCIAL IMPACT: None F.LEGAL CONSIDERATION: The City Attorney has reviewed the change and approved of its contents. ALTERNATIVE RECOMMENDATION(S): The recommended update to city code will align with State law when fully approved. PRINCIPAL PARTIES EXPECTED AT MEETING: ATTACHMENTS: Description Type Grass height Cover Memo 1 0 = 1 " " RC160\3\751810.v1 RC160\3\751810.v1 RC160\3\751810.v1 BILL NO. _____ AN ORDINANCE AMENDING SECTION 925 OF THE RICHFIELD CODE OF ORDINANCES PERTAINING TO PUBLIC NUISANCES AND GRASS HEIGHT THE CITY OF RICHFIELD DOES ORDAIN: Section 1. Sub-section 925.01 Subd. 2 of the Richfield Code of Ordinances is hereby amended by adding the following double-underlined language and deleting the following struck-through language below: 925.01. – Public Nuisances Subdivision 2. Public nuisances affecting health. The following are declared to be nuisances affecting public health: (g) Poisonous plants including but not limited to poison ivy, poison oak, and ragweed, plants detrimental to health; and growth of weeds, grass, brush or other rank vegetation to a greater height than six (6) eight (8) inches on the average; and accumulations of dead weeds, grass or brush; Section 2. This ordinance will be effective in accordance with Section 3.09 of the City Charter. Adopted by the City of Richfield this ___ day of _________, 2025. Mary Supple, Mayor ATTEST: Michelle Friedrich, City Clerk AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #3.B. STAFF REPORT NO. 23 CITY COUNCIL MEETING 2/11/2025 REPORT PREPARED BY:John Evans, Analyst DEPARTMENT DIRECTOR REVIEW:Karl Huemiller, Recreation Services Director OTHER DEPARTMENT REVIEW: CITY MANAGER REVIEW: Katie Rodriguez, City Manager 2/5/2025 ITEM FOR COUNCIL CONSIDERATION: Consider a resolution authorizing the designation of $1,000,000 in City of Richfield Capital Reserve Funds to serve as assurance of funding for the Wood Lake Nature Center Building Project, for the purposes of releasing funds from the 2023 State of Minnesota Appropriations Bill, administered by the MN Department of Employment and Economic Development, in the amount of $12,000,000. EXECUTIVE SUMMARY: In 2023, the State of Minnesota allocated $12,000,000 in 2023 appropriations bill funds for the Wood Lake Nature Center Building Project. In order to release those funds to be used for the reimbursement of costs related to the project, the City of Richfield must also demonstrate full and available funding for the project budget. By referendum and City Council Resolution No. 12111, $11,000,000 was authorized for use from a local sales and use tax. In 2025, $10,000,000 of this was issued in general obligation bonds, with proceeds and bond premium of $572,887 being immediately available for the project, while $427,113 is planned for the Wood Lake Building Project from bond proceeds anticipated to be issued in 2026. The Minnesota Department of Employment and Economic Development has requested that the City provide a commitment of available funds for the unissued project bond funding and contingency, for combined total of $617,044. Through the annual Capital Improvement Budget process, the City Council has already approved the project budget and all sources of funding, including $225,000 from Richfield Liquor Store proceeds for the Project. The City has available capital reserves funds that, by resolution, can be designated to assure full and immediate project funding. RECOMMENDED ACTION: By motion: Approve a resolution authorizing the designation of $1,000,000 in City of Richfield Capital Reserve Funds to serve as assurance of funding for the Wood Lake Nature Center Building Project for the purposes of releasing funds from the 2023 State of Minnesota Appropriations Bill, administered by the MN Department of Employment and Economic Development, in the amount of $12,000,000. BASIS OF RECOMMENDATION: A.HISTORICAL CONTEXT The Wood Lake Nature Center Building Project will replace the existing building, built in 1971, and ensure the continuation of the provision of services and public facilities that have promoted interaction with the natural environment and have provided environmental education and recreation for 54 years. This funding assurance is required by the State of Minnesota to release the $12,000,000 awarded through the Appropriations Bill of 2023. B.EQUITABLE OR STRATEGIC CONSIDERATIONS OR IMPACTS Impact: Wood Lake Nature Center is an amenity that is free to the public and has been heavily utilized for over 50 years. Habitat restoration and preservation is vital to ensuring the continuation of these services for many years to come. People: The Recreation Services Department has an ongoing commitment to provide programs and facilities that are accessible and inviting to all people, regardless of ethnicity, gender identification, or economic status. Wood Lake Nature Center is uniquely located to provide access to nature for all members of our community. Consequences: The Recreation Services Department has been proactive about creating a welcoming environment for all people and we have seen diverse participation. Staff realizes that these facilities are made possible by all of Richfield residents and strives to take steps to ensure that our participants reflect that diversity and individuality. Strategic Outcome Considerations: A new and efficient building and surrounding infrastructure is a vital piece of ensuring the success of Wood Lake's environmental education programs into the future. C.POLICIES (resolutions, ordinances, regulations, statutes, exc): The State of Minnesota Department of Employment and Economic Development requires the assurance of full and immediate project funding in order to approve the release of the $12,000,000 in appropriations funding as a reimbursement award. M.S. § 412.201 requires the Mayor and Council of all statutory cities to to authorize by resolution the execution of all grant agreements and the administration of grant funds. D.CRITICAL TIMING ISSUES: Staff will need to proceed with the administration of the grant agreement and the release of grant funds in order to proceed with the building project in a timely manner. E.FINANCIAL IMPACT: The grant provides nearly half of the funds necessary to proceed with, and complete, the Wood Lake Nature Center Building Project. F.LEGAL CONSIDERATION: There are no legal considerations for this item. ALTERNATIVE RECOMMENDATION(S): Reject the resolution and delay the release of the $12,000,000 State of Minnesota award. PRINCIPAL PARTIES EXPECTED AT MEETING: ATTACHMENTS: Description Type Resolution authorizing $1m in reserve funds for assurance of funding for Wood Lake Project Resolution Letter 2025-2-11 Capital Reserve Funds for Wood Lake Project CITY OF RICHFIELD RESOLUTION NO. RESOLUTION AUTHORIZING THE DESIGNATION OF $1,000,000 IN CITY OF RICHFIELD CAPITAL RESERVE FUNDS TO SERVE AS ASSURANCE OF FUNDING FOR THE WOOD LAKE NATURE CENTER BUILDING PROJECT FOR THE PURPOSES OF RELEASING FUNDS FROM THE 2023 STATE OF MINNESOTA APPROPRIATIONS BILL, ADMINISTERED BY THE MN DEPARTMENT OF EMPLOYMENT AND ECONOMIC DEVELOPMENT, IN THE AMOUNT OF $12,000,000. WHEREAS, the City of Richfield has secured full funding for the Wood Lake Nature Center Building Project, including $12,000,000 allocated from the State of Minnesota 2023 Appropriations Bill for the Wood Lake Nature Center Building Project; and WHEREAS, the Minnesota Department of Employment and Economic Development administers the distribution of these funds and requires documentation of full funding of the project from all sources prior to release of state funds; and WHEREAS, the City Council adopted Resolution No. 12111 approving $11,000,000 in funding for the project to be sourced from a sales and use tax of one-half of one percent, which will secure and pay debt service on general obligation bonds issued to finance a portion of the project; and WHEREAS, the City plans bond issuances to meet the cash flow needs of this and other projects and, in 2025, issued GO sales tax bonds in the amount of $10,000,000, with proceeds and bond premium of $572,887 being immediately available for the project, while $427,113 is planned for the Wood Lake Building Project from bond proceeds anticipated to be issued in 2026; and WHEREAS, the Minnesota Department of Employment and Economic Development has requested the City provide commitment available funds for the unissued project bond funding and contingency for a combined total of $617,044; and WHEREAS, through the annual Capital Improvement Budget process, the City Council has already approved the project budget and all sources of funding, including $225,000 from Richfield Liquor Store proceeds for the Project; and WHEREAS, the City has available capital reserves funds of more than $1,000,000, demonstrating full and immediate project funding. NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Richfield, Minnesota, as follows: The City Council of the City of Richfield hereby authorizes the designation of $1,000,000 in City of Richfield Capital Reserve Funds to serve as assurance of funding for the Wood Lake Nature Center building project, demonstrating full and immediate availability of all necessary funds for the project, as required by the State of Minnesota for the release of 2023 Minnesota Appropriations Bill funding in the amount of $12,000,000. Adopted by the City Council of the City of Richfield, Minnesota this 11th day of February, 2025. Mary Supple, Mayor ATTEST: Michelle Friedrich, City Clerk AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #3.C. STAFF REPORT NO. 24 CITY COUNCIL MEETING 2/11/2025 REPORT PREPARED BY:Jennifer Anderson, Support Services Manager DEPARTMENT DIRECTOR REVIEW:Jay Henthorne, Director of Public Safety/Chief of Police 1/27/2025 OTHER DEPARTMENT REVIEW: CITY MANAGER REVIEW: Katie Rodriguez, City Manager 2/5/2025 ITEM FOR COUNCIL CONSIDERATION: Consider the approval of the first amendment to the Foundational Public Health Responsibilities (FPHR) agreement with the City of Bloomington. EXECUTIVE SUMMARY: The Foundational Public Health Responsibilities are the unique responsibilities of governmental public health that define a minimum package of public health capabilities and programs that must be available in every community. This funding must be used to fulfill foundational public health responsibilities as defined by the commissioner in consultation with the State Community Health Service Advisory Committee. The City Council accepted and approved the funding from the Minnesota Department of Health at the January 23, 2024 City Council meeting. RECOMMENDED ACTION: By motion: Approve the the first amendment to the Foundational Public Health Responsibilities agreement with the City of Bloomington, extending the agreement through June 30, 2026 BASIS OF RECOMMENDATION: A.HISTORICAL CONTEXT Governmental public health has a unique responsibility for protecting and promoting the health of the public. While Minnesota’s nationally recognized state-local public health partnership has served Minnesotans well since it was established in 1976, many state and local health officials have serious concerns about their ability to fulfill that responsibility. A number of challenges have left us all at risk—increasing demands on decreasing resources, the changing role of public health from providing direct services to broader population-based prevention activities, new health threats, disparities in health status, decreasing budgets, and hiring challenges—to name a few. A group of local and state public health leaders developed a framework for what Minnesotans should expect from their state and local public health partnership. This framework outlines a set of foundational public health responsibilities that are grounded by a core value: where you live should not determine your level of public health protection. The framework also recognizes that diseases and disasters do not distinguish geographic boundaries. The framework is intentionally forward-looking and focused on what should be instead of what is. The framework represents the work governmental public health must do, and the important work governmental public health does, to meet the unique needs of communities across the state. Exhibit C of the agreement outlines the scope of services Bloomington Public Health will complete in partnership with Richfield's CHS Administrator, and Exhibit D outlining the terms of payment. B.EQUITABLE OR STRATEGIC CONSIDERATIONS OR IMPACTS Embedding health equity is a requirement within the new public health framework the Minnesota Department of Health recently adopted. This will strengthen the foundation of communicable disease control, chronic disease and injury prevention, environmental health, maternal child and family health, and access to clinical care. C.POLICIES (resolutions, ordinances, regulations, statutes, exc): Public Health departments across Minnesota are mandated by Minnesota Statue 145A to provide 6 areas of public health responsibilities: Assure an adequate local public health infrastructure Promote healthy communities and healthy behaviors Prevent the spread of communicable diseases Protect against environmental health hazards Prepare for and respond to emergencies Assure health services D.CRITICAL TIMING ISSUES: No critical timing issues. E.FINANCIAL IMPACT: Richfield's allotment of FPHR funding for 2024 was $220,548. Richfield's allotment of FPHR funding for 2025 is $216,045 and was approved at the December 10, 2024 City Council meeting. These funds will continue to cover the agreement with the City of Bloomington. F.LEGAL CONSIDERATION: The City Attorney has reviewed the agreement and approves of its contents. ALTERNATIVE RECOMMENDATION(S): The City Council could decide not to approve the first amendment with the City of Bloomington and direct staff on how to proceed. PRINCIPAL PARTIES EXPECTED AT MEETING: ATTACHMENTS: Description Type FPHR First Amendment Cover Memo Agreement ID: 2025-10 FIRST AMENDMENT TO FOUNDATIONAL PUBLIC HEALTH RESPONSIBILITIES SERVICES AGREEMENT BETWEEN THE MINNESOTA CITIES OF BLOOMINGTON AND RICHFIELD THIS FIRST AMENDMENT is made on ______________________ by and between CITY OF BLOOMINGTON, a Minnesota municipal corporation located at 1800 West Old Shakopee Road, Bloomington, Minnesota 55431 (“Bloomington”), and CITY OF RICHFIELD, MINNESOTA, a Minnesota municipal corporation located at 6700 Portland Avenue, Richfield, Minnesota 55423 (“Richfield”). Bloomington and Richfield are herein referred to collectively as the “Parties.” WHEREAS, Bloomington and Richfield are parties to an Agreement dated January 1, 2024 (Agreement ID 2024-043) pursuant to which Bloomington is responsible for providing Foundational Public Health Responsibilities Services to the Residents of Richfield (“Agreement”); and WHEREAS, the term of the Agreement ends June 30, 2025. Parties desire to amend the Agreement to extend the term until June 30, 2026; and WHEREAS, Parties desire to amend the Agreement to include additional services as detailed in Exhibit C, and update the terms of payment in Exhibit D; and WHEREAS, Parties desire to amend the Agreement to increase the total amount of work authorized, including reimbursable expenses, by $216,045.00 for a total contract not-to-exceed amount of $436,593.00; and NOW, THEREFORE, in consideration of the terms and conditions expressed in this First Amendment, Parties agree as follows: 1. Paragraph 1 of the Agreement shall be amended to read: “Services to be Provided: Bloomington agrees to provide the residents of Richfield with Foundational Public Health Responsibilities Services as described in the Scope of Services attached to this Agreement as Exhibits A and C or any supplemental letter agreements entered into between the Parties (“Services”). The Services referenced in the attached Exhibits A and C or any supplemental letter agreements shall be incorporated into this Agreement by reference. All Services shall be provided in a manner consistent with the level of care and skill ordinarily exercised by contractors currently providing similar services.” 2. Paragraph 2 of the Agreement shall be amended to read: “Time for Completion. This Agreement shall remain in force and effect commencing from Effective Date and continuing until June 30, 2026, unless terminated by either Party or amended pursuant to the Agreement.” 3. Paragraph 3 of the Agreement shall be amended to read: “Consideration: The consideration, which Richfield shall pay to Bloomington, shall not exceed $436,593.00, pursuant to the terms of payment set forth in Exhibit B and D and incorporated into this Agreement. 2 4. All other terms and conditions of the Agreement not modified by this First Amendment shall remain in full force and effect. IN WITNESS WHEREOF, the parties to the Agreement have caused this First Amendment to be executed the day and year first above written. CITY OF BLOOMINGTON, MINNESOTA DATED:_______________________ BY:________________________________ Its: Mayor DATED:_______________________ BY:________________________________ Its: Interim City Manager Reviewed and approved by the City Attorney. __________________________________ City Attorney CITY OF RICHFIELD, MINNESOTA DATED:_______________________ BY:________________________________ Its: City Manager 3 EXHIBIT C TO FOUNDATIONAL PUBLIC HEALTH RESPONSIBILITES SERVICES AGREEMENT BETWEEN THE MINNESOTA CITIES OF BLOOMINGTON AND RICHFIELD SCOPE OF SERVICES The purpose of this funding is to support the implementation of Foundational Public Health Responsibilities (FPHR) by community health boards (grantees). The FPHR are the unique responsibilities of governmental public health that define a minimum package of public health capabilities and programs that must be available in every community. This funding must be used to fulfill foundational public health responsibilities as defined by the Commissioner of Health in consultation with the State Community Health Service Advisory Committee (SCHSAC). Based on the recommendation of SCHSAC, Grantees cannot use these funds for non-FPHR activities at this time. More details on the Foundational Public Health Responsibilities and examples of the work supported by these funds can be found on the MDH website: Funding for Foundational Public Health Responsibilities. Duties: 1. Bloomington and Richfield shall complete, and update as necessary, proposed activities and a workplan for MDH approval in REDCap. This workplan will assure compliance with funding requirements and make connections with other grantees. Any changes made to the original proposal must be reviewed and approved by MDH. 2. Bloomington and Richfield shall complete a proposed budget in REDCap by the date provided to them by MDH. Any revisions made to the original budget must be made in REDCap and reviewed by MDH. 3. Bloomington and Richfield shall implement activities to carry out foundational public health responsibilities in accordance with the definitions outlined on the Funding for Foundational Public Health Responsibilities website and Foundational Public Health Responsibilities Grant Expenditure Guide. 4. Bloomington and Richfield shall provide requested financial and programmatic reporting information by the dates provided to them by MDH to meet funding reporting and monitoring requirements. 4 EXHIBIT D TO FOUNDATIONAL PUBLIC HEALTH RESPONSIBILITES SERVICES AGREEMENT BETWEEN THE MINNESOTA CITIES OF BLOOMINGTON AND RICHFIELD TERMS OF PAYMENT A. The Parties agree to allocate the costs of the Services in accordance with each city’s share of the total services provided by Bloomington to all three cities (Bloomington, Edina, and Richfield) as identified below. During the term of this Agreement, Richfield shall pay Bloomington the total not-to- exceed amount of $436,593.00 for Foundational Public Health Services. Share of total cost Allocation Method Bloomington Edina Richfield Costs shared equally with an adjustment for social vulnerability index of each city 36% 28% 36% B. Bloomington will provide quarterly itemized invoices to Richfield on the following dates: Invoice Dates: April 15, 2025 July 15, 2025 October 15, 2025 January 15, 2026 April 15, 2026 July 15, 2026 C. Richfield shall make payment to Bloomington within 30 days of receipt of Bloomington’s invoice. AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #3.D. STAFF REPORT NO. 25 CITY COUNCIL MEETING 2/11/2025 REPORT PREPARED BY:Jennifer Anderson, Support Services Manager DEPARTMENT DIRECTOR REVIEW:Jay Henthorne, Director of Public Safety/Chief of Police 1/27/2025 OTHER DEPARTMENT REVIEW: CITY MANAGER REVIEW: Katie Rodriguez, City Manager 2/5/2025 ITEM FOR COUNCIL CONSIDERATION: Consider approval of a fifth amendment to the agreement with the City of Bloomington for the provision of public health services for the City of Richfield for 2025. EXECUTIVE SUMMARY: The City of Richfield has had a public health contract with the City of Bloomington to provide public health services on Richfield's behalf for 48 years. The amendment to the public health contract requires City Council approval and reflects a 4 percent increase over the 2024 amendment amount. RECOMMENDED ACTION: By motion: Approve the fifth amendment to the agreement with the City of Bloomington for the provision of public health services for the City of Richfield for 2025. BASIS OF RECOMMENDATION: A.HISTORICAL CONTEXT In 1977, the State of Minnesota enacted the Community Health Services Act which transferred the responsibility for the administration of public health programs to local jurisdictions. The State also provided funds for the program and encouraged local jurisdictions to increase the efficiency of their programs by grouping together whenever it made sense to do so. Richfield entered into a contractual agreement with Bloomington at that time and the program has been administered under a contract with them since. The Act was revised in 2003 and is now referred to as the Local Public Health Act. The contract amount for providing public health services in 2025 reflects a 4% increase over the 2024 contract amount. The contract amount for 2025 is $342,160; with the 2024 contract amount having been $329,000. In 2004, changes were made to the Public Health Act at the State level to make reporting, accountability, and record keeping more efficient. Those changes also "regrouped" a large number of funding sources into one, which gives more personalization of the funds for the best specific user of the dollars within the community to be used in conjunction with subsidy guidelines. It is now referred to as the Local Public Health grant. B.EQUITABLE OR STRATEGIC CONSIDERATIONS OR IMPACTS Public Health services in Richfield are provided to all residents, which include activities designed to protect and promote the health of the general population within a community by emphasizing the prevention of disease, injury, disability, and preventable death through the promotion of effective coordination and use of community resources. C.POLICIES (resolutions, ordinances, regulations, statutes, exc): Community Health Boards are mandated by Minnesota State Statute 145A to perform core public health services, which are funded by a combination of local, state and federal dollars. Local public health departments partner with other government agencies and community organizations such as schools, law enforcement, social services, nonprofits, and health care providers to coordinate high quality, collaborative public health programs that fulfill state mandates and address local health priorities. D.CRITICAL TIMING ISSUES: No critical timing issues. E.FINANCIAL IMPACT: The cost of the annual contract between Richfield and Bloomington for public health services has typically been covered by the Local Public Health (LPH) grant and mandatory 75% local match for the Richfield Community Health Board. F.LEGAL CONSIDERATION: The City Attorney has reviewed the amendment and approves of its contents. ALTERNATIVE RECOMMENDATION(S): The City Council could deny the amendment to the contract and public health services provided by Bloomington Public Health Department would no longer be provided for the City of Richfield. PRINCIPAL PARTIES EXPECTED AT MEETING: ATTACHMENTS: Description Type Local Public Health Services Amendment (R1)Contract/Agreement Agreement ID: 2024-6 FIFTH AMENDMENT TO LOCAL PUBLIC HEALTH SERVICES AGREEMENT BETWEEN THE MINNESOTA CITIES OF BLOOMINGTON AND RICHFIELD THIS FIFTH AMENDMENT is made on ______________________ by and between CITY OF BLOOMINGTON, a Minnesota municipal corporation located at 1800 West Old Shakopee Road, Bloomington, Minnesota 55431 (“Bloomington”), and CITY OF RICHFIELD, a Minnesota municipal corporation, located at 6700 Portland Avenue, Richfield, Minnesota 55423 (“Richfield”), each a “Party” and collectively the “Parties.” WHEREAS, Bloomington and Richfield are parties to an Agreement dated January 1, 2020 (Agreement ID 2019-650), as amended by a First Amendment dated December 29, 2020 (Agreement ID 2020-518), as amended by a Second Amendment dated January 21, 2022 (Agreement ID 2021-766), as amended by a Third Amendment dated December 4, 2022 (Agreement ID 2022-832), as amended by a Fourth Amendment dated December 28, 2023 (Agreement ID 2023-803), pursuant to which Bloomington is responsible for providing Public Health Services to residents of Richfield (“Agreement”); and WHEREAS, the term of the Agreement ends December 31, 2024. Parties desire to amend the Agreement to extend the term until December 31, 2025; and WHEREAS, Parties desire to amend the Agreement to include additional services for the 2025 contract year as set forth in Exhibit K , and updated pricing for the 2025 contract year as set forth in Exhibit L; and WHEREAS, Parties desire to amend the Agreement to increase the total amount of work authorized, including reimbursable expenses, by $342,160.00 for a total contract not-to-exceed amount of $1,767,160.00; and NOW, THEREFORE, in consideration of the terms and conditions expressed in this Fifth Amendment, Parties agree as follows: 1.Paragraph 1 of the Agreement shall be amended to read: “Services to be Provided: Bloomington agrees to provide the residents of Richfield with Public Health Services as set forth in Bloomington’s Scope of Services attached to this Agreement as Exhibits A, C, E, G, H, I and K or any supplemental letter agreements entered into between the Parties (“Services”). The Services referenced in the attached Exhibits A, C, E, G, H, I and K or any supplemental letter agreements shall be incorporated into this Agreement by reference. All Services shall be provided in a manner consistent with the level of care and skill ordinarily exercised by contractors currently providing similar services.” 2.Paragraph 2 of the Agreement shall be amended to read: “Time for Completion. This Agreement shall remain in force and effect commencing from January 1, 2025 and continuing until December 31, 2025, unless terminated by either Party or amended pursuant to the Agreement.” 3.Paragraph 3 of the Agreement shall be amended to read: “Consideration: The consideration, which Richfield shall pay to Bloomington and shall not exceed 2 $1,767,160.00, pursuant to the terms of the payment set forth in Exhibit L and incorporated into this Agreement. 4.All other terms and conditions of the Agreement not modified by this Fifth Amendment shall remain in full force and effect. IN WITNESS WHEREOF, the parties to the Agreement have caused this Fifth Amendment to be executed the day and year first above written. CITY OF BLOOMINGTON, MINNESOTA DATED:_______________________ BY:________________________________ Its: Mayor DATED:_______________________ BY:________________________________ Its: City Manager Reviewed and approved by the City Attorney. __________________________________ City Attorney CITY OF RICHFIELD, MINNESOTA DATED:_______________________ BY:________________________________ Its:___________________________ 3 EXHIBIT K TO LOCAL PUBLIC HELTH SERVICES AGREEMENT BETWEEN THE MINNESOTA CITIES OF BLOOMINGTON AND RICHFIELD SCOPE OF SERVICES 1.Bloomington agrees to provide residents of Richfield with Public Health Services, which include activities designed to protect and promote the health of the general population within a community health service area by emphasizing the prevention of disease, injury, disability, and preventable death through the promotion of effective coordination and use of community resources, and by extending Public Health Services into the community. 2.Bloomington agrees to provide Public Health Services to the residents of Richfield in a manner consistent with the level of care and skill ordinarily exercised, and utilizing the same quality and kind of personnel, equipment and facilities, as Public Health Services are provided and rendered to residents of Bloomington. 3.Bloomington shall provide the Public Health Services pursuant hereto on a confidential basis, using capable, trained professionals. 4.Bloomington shall require medical malpractice insurance coverage by its physicians and other licensed professionals with whom Bloomington has a contract for professional services. 5.All Public Health Services to be rendered hereunder by Bloomington shall be rendered pursuant to and subject to public health policies, rules, and procedures now or hereafter, from time to time, adopted by the Bloomington City Council, and in full compliance with all applicable state and federal laws. 6.It shall be Bloomington's sole responsibility to determine the qualifications, functions, training, and performance standards for all personnel rendering Public Health Services under this Agreement. 7.Bloomington will communicate with Richfield relative to Public Health Services to be performed hereunder, in the form of reports, conferences, or consultations, as Richfield shall request. All reports relating to the provision of Public Health Services that are given by Bloomington to the Bloomington City Council or to the Bloomington City Manager during the term of this Agreement shall also be given to Richfield. 8.Bloomington also agrees to send to Richfield an annual report describing the Public Health Services performed pursuant to this 4 Agreement. Said report shall be in such detail and form as Richfield may reasonably request. Also, at Richfield’s request, made not more than five (5) times during the term of this Agreement, responsible administrative officers of Bloomington's Division of Public Health shall attend meetings of the Richfield City Council, or appropriate board or commission, to answer questions and give further information relative to the activities performed and Public Health Services rendered under this Agreement. 9.Bloomington will also provide services to Richfield for Title V Maternal Child Health (MCH) and Temporary Assistance to Needy Families (TANF) to qualifying women, infants, children and adolescents. Richfield agrees to assign its rights to Minnesota Department of Health (MDH) funding provided for the MCH and TANF programs for fiscal year 2025 to Bloomington. Bloomington will complete all required services, reports and documentation for these programs and will directly invoice MDH for the MCH and TANF services that Bloomington provides to Richfield residents. 5 EXHIBIT L TO LOCAL PUBLIC HEALTH SERVICES AGREEMENT BETWEEN THE MINNESOTA CITIES OF BLOOMINGTON AND RICHFIELD TERMS OF PAYMENT 1. The parties agree to allocate the costs of the Services in accordance with each city's share of the total services provided by Bloomington to all three cities (Bloomington, Edina, and Richfield) as identified below. 2.Richfield shall pay Bloomington the total not-to-exceed amount of $1,767,160.00 for Services during the term of this Agreement. Allocation method Description of Service Share of total cost Bloomington Edina Richfield Agreed-upon Administration and 65% 17.5% 17.5% percentage of Planning & Health cost Promotion infrastructure (fixed) Internal service 80% 10% 10% charges Accreditation 33% 33% 33% By population (as estimated by the American Community Survey) DP&C Community Resource Team Outbreak response SHIP 49% 30% 21% By number of Maternal Health Share of total cost will change each year based on # of clients per city, according to the following formula: (Clients served in Edina) ------------------------------------------ = share of total cost (Clients served in all three cities) clients in each city Clinical Services (changes annually) Direct expense All others Cost of service provided 6 3.Bloomington will invoice Richfield for the Services according to the following terms: Invoice Date Amount April 15, 2025 $85,540 July 15, 2025 $85,540 October 15, 2025 $85,540 January 15, 2026 $85,540 4.Richfield shall make payment to Bloomington within thirty (30) days of receipt after Bloomington's invoice. AGENDA SECTION:RESOLUTIONS AGENDA ITEM #5. STAFF REPORT NO. 26 CITY COUNCIL MEETING 2/11/2025 REPORT PREPARED BY:Ruby Villa, Planner I DEPARTMENT DIRECTOR REVIEW:Melissa Poehlman, Community Development Director 2/4/2025 OTHER DEPARTMENT REVIEW: CITY MANAGER REVIEW: Katie Rodriguez, City Manager 2/5/2025 ITEM FOR COUNCIL CONSIDERATION: Consider a request for site plan approval of an entirely new Wood Lake Nature Center building at 6710 Lake Shore Drive. EXECUTIVE SUMMARY: HGA (Applicant), on behalf of the Richfield Recreation Services Department, has submitted an application for site plan approval to construct a new Wood Lake Nature Center building at 6710 Lake Shore Drive. As most parks in the City, the property is zoned R Low Density Residential. Governmental buildings are a permitted use in this district; site plan review is required due to the construction of a new building. The proposed site plan is designed to provide a new one-story building that will be twice the size of the existing building. The new building will be 40 feet farther from the lake and 80 feet closer to the street. It will be characterized by dark brown wood siding and green roof forms. In the interior, it will include an improved lobby, exhibits, lounge and conference spaces, multipurpose rooms for educational programming and rentals, and staff office space. The parking lot will be improved through the addition of landscaping, perimeter plantings, and Electric Vehicle (EV) chargers, but it will remain mostly unchanged. Construction is set to begin in the Spring of this year, completing in the Spring/Summer of 2026. See the Applicant’s narrative for more information. No variances are requested as part of the project but there are certain modifications necessary in regard to landscaping requirements. As discussed in the "Policy" section below, staff finds these modifications reasonable based on the unique nature of the property and the project’s sustainability and energy reduction features. Staff recommends approval of the project, subject to the conditions listed in the draft resolution of approval. RECOMMENDED ACTION: By motion: Adopt a resolution approving the site plan for a new Wood Lake Nature Center building at 6710 Lake Shore Drive. BASIS OF RECOMMENDATION: A.HISTORICAL CONTEXT The existing facility was built and opened its doors in 1971. It was one of the first nature centers built in the Twin Cities. Conversations regarding construction of a new facility began in 2021, followed by pre-design planning. Following a Request for Proposal (RFP) process in 2023, the Applicant was chosen to provide architectural and engineering services for the design and construction administration of the new facility. Three open houses, a survey, and four engagement sessions were held in 2024 as part of public engagement initiatives. The public input received as part of these initiatives was used to help develop an initial design of the new facility. The Planning Commission held a public hearing on January 27, 2025. A brief presentation was provided by Karl Huemiller, Recreation Services Director. No members of the public spoke. The Commission voted 6-0 to recommend approval of the request. B.EQUITABLE OR STRATEGIC CONSIDERATIONS OR IMPACTS Equity: The existing building no longer adequately serves the needs of the Wood Lake Nature Center or the community. It is outdated, too small for desired programming, and not accessible. The new building has been designed in an effort to serve Richfield residents and visitors beyond, including those of marginalized communities, such as those with disabilities, people whose incomes are below the federal poverty threshold and Black, Indigenous, Hispanic, Asian and other people of color. The proposed facility will comply with current ADA guidelines and will include accessibility features such as a sensory room, a lactation room, and family bathrooms. The parking lot will also be improved to provide for wider walkways to accommodate pedestrians, wheelchair users, and bicyclists. With increased learning space and educational exhibits, the center will continue to provide free general entry and free or reduced cost events and programming, such as environmental education field trips for local public schools. Notably, about 70% of the Richfield Public School district’s students are of color. Strategic Plan: This project aligns with multiple strategic plan priorities. As a highly sustainable project which will meet rigorous energy efficiency guidelines and targets, it aligns most with the Sustainable Infrastructure priority. The new building will use high performing exterior materials, a geothermal system, and roof mounted solar panels. There will also be onsite stormwater management and use of drought-resistant native plantings. As a Nature Facility located just outside the border of what is traditionally considered “downtown," the project also aligns with the Community Development priority. A larger building with greater accessibility features will attract visitors and contribute to a “vibrant” downtown. C.POLICIES (resolutions, ordinances, regulations, statutes, exc): Application materials were shared with the Minnesota Department of Natural Resources. No significant comments were received. Zoning Code Section 547.13 establishes various criteria and standards for site plan review. The proposed site plan meets or exceeds these requirements. The attached findings of fact provide further support for staff’s recommendation for approval. Zoning Code Section 514 establishes R District requirements for nonresidential buildings. The project meets setback and height requirements, as well as lot coverage and impervious surface. Zoning Code Section 544 establishes general building and performance standards, which include landscaping requirements, parking requirements, screening requirements, and architectural standards. A majority of landscaping and screening requirements are met, with the exception of the following: Due to the unique nature of the use, the Applicant is requesting a modification regarding the requirement for irrigation (below). In instances in which an Applicant is unable to meet the requirements of Section 544.03, Subd. 4 – 7, the City may review and decide the adequacy of each landscaping and screening design based on whether or not it meets the intent of this ordinance. Irrigation: “All landscaped areas within new developments or developments with additions of 100 percent of gross floor area or more shall be irrigated by an underground mechanical irrigation system. All other sites are highly encouraged to install irrigation systems.” (Section 544.01, Subd. 4.h). The use of drought tolerant native plantings eliminates the need for long-term irrigation. Hose bibs will also be located at consistent intervals around the building to maintain plantings in drought conditions. It is staffs’ opinion that, for these reasons and others stated in the applicant’s narrative, the intent of this requirement - to keep plants alive – will be met and irrigation should not be required. Landscaping Quantities (Section 544.03, Subd. 6) Landscaping for commercial and mixed-use sites is required at the rate of one tree per 2,500 square feet of Developable Landscaping Area and one shrub per 1,000 square feet of Developable Landscaping Area (defined as the total area of a development site or phase minus the portion of that area within a natural water body or a protected wetland). For this 64.5-acre site that would mean more than 1,000 trees and almost 3,000 shrubs. As a nature center, and the largest and most ecologically varied property in the City – with a diversity of natural biomes which include marsh, wetland, prairie, and woodland with hundreds of existing trees – some flexibility in regard to this requirement is warranted. Per Section 544.03, Subd.4.i, in instances where healthy plant materials exist on a lot prior to development, the application of landscaping standards may be adjusted by the City to allow credit for such material, provided that such adjustment is consistent with the intent of the Code. Staff finds this to be a prime example of such. Of 718 existing trees (which were surveyed in 2024) within the northernmost 11-acres of the property, about 75 will be removed to accommodate the new building and 13 will be transplanted elsewhere on site. Fourteen new trees will also be planted. Screening (Section 544.05) Refuse collection, recycling and utilitarian elements are required to be designed into the interior space of buildings. While not technically inside the building, the fully enclosed area connected to the rear east portion of the building will be covered by a wide eave overhang and will be enclosed with exterior materials that match all other elements of the building. Additionally, there will be an interior door in order for staff to access refuse containers from the inside of the building. Staff finds that the intent of the requirement for internal refuse collection is met. D.CRITICAL TIMING ISSUES: 60-DAY RULE: The 60-day clock started when a complete application was received on January 7, 2025. Therefore, the 60-day clock ends on March 8, 2025. A decision is required by this date, or the City must notify the Applicant that it is extending the deadline (up to a maximum of 60 additional days or 120 days total) for issuing a decision. E.FINANCIAL IMPACT: None; required application fees have been paid. F.LEGAL CONSIDERATION: Notice of the public hearing was published in the Sun Current newspaper on January 16, 2025, and was mailed to properties within 350 feet of the subject site. The Planning Commission held a public hearing on January 27, 2025, and unanimously recommended approval of the request as presented. ALTERNATIVE RECOMMENDATION(S): Approve the request with additional and/or modified stipulations. Deny the request with a finding that the proposal does not meet City requirements. PRINCIPAL PARTIES EXPECTED AT MEETING: Karl Huemiller, Recreation Services Director ATTACHMENTS: Description Type Resolution of Approval Resolution Letter Location and Zoning Map Backup Material Required Findings Backup Material Applicant's Narrative Backup Material Site Plans Backup Material Exterior Renderings Backup Material Exterior Elevations Backup Material Floor Plan Backup Material Landscape Plan Set Backup Material Photometric Plan Backup Material RESOLUTION NO. RESOLUTION APPROVING A SITE PLAN AT 6710 – LAKE SHORE DRIVE WHEREAS, an application has been filed with the City of Richfield which requests site plan approval to construct a new Wood Lake Nature Center facility at 6710 Lake Shore Drive, land legally described in Exhibit A, attached; and WHEREAS, the Planning Commission of the City of Richfield held a public hearing and recommended approval of the requested Site Plan at its January 27, 2025 meeting; and WHEREAS, notice of the public hearing was mailed to properties within 350 feet of the subject property, and published in the Sun-Current on January 16, 2025; and WHEREAS, the request meets those requirements necessary for approving a Site Plan as specified in Richfield’s Zoning Code, Section 547.13, Subd. 8 and as detailed in City Council Staff Report No.___; and WHEREAS, the City has fully considered the request for approval of a site plan; and NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Richfield, Minnesota, as follows: 1. The City Council adopts as its Findings of Fact the WHEREAS clauses set forth above, and the findings listed in the Required Findings Statement. 2. A site plan is approved for a new Wood Lake Nature Center facility of 17,000 square feet of gross floor area as described in City Council Report No. ___, on the Subject Property legally described as attached. 3. The approved site plan is subject to the following conditions: a) Prior to issuance of construction permits, plans shall be revised to comply with outstanding items related to bicycle parking and landscaping, as detailed in the City’s Administrative Review Committee Report dated January 3, 2025. b) The applicant is responsible for obtaining all required permits, and compliance with all other City, County and State regulations, including the MN Department of Natural Resources. c) Bike racks shall be installed according to manufacturer specifications. d) This does not constitute approval of any signage; sign permits are required and must be applied for separately. e) Prior to the issuance of an occupancy permit the applicant must submit a surety equal to 125% of the value of any required improvements or conditions of approval that are not yet complete. f) The property owner is responsible for the ongoing maintenance and tending of all exterior improvements in accordance with approved plans. 4. This approval shall expire one year from issuance unless the use for which the permit was granted has commenced, substantial work has been completed or upon written request by the applicant, the Council extends the expiration date for an additional period, as required by the Zoning Ordinance, Section 547.13, Subd. 9. Adopted by the City Council of the City of Richfield, Minnesota this 11th day of February, 2025. Mary B. Supple, Mayor ATTEST: Michelle Friedrich, City Clerk Exhibit A JAMES AVE SIRVINGAVESHUMBOLDT AVE SGIRARD AVE SEMERSON AVE S65TH ST W LYNDALEAVES72ND ST W 70TH ST W PLEASANT AVE68TH ST W PILLSBURY AVE73RD ST W 68TH ST W 71ST ST W 72ND ST W HARRIET AVEDUPONTAVES66TH ST W OAKGROVEBLVD67TH ST W BRYANTAVES71ST ST W RAEDR GARFIELDAVE70TH ST W 73RD ST W WENTWORTH AVEHUMBOLDT AVE SLAKESHOREDRSPILLSBURY AVE69TH ST W 67TH ST W EMERSONAVESGARFIELD AVEGRAND AVE SWENTWORTH AVEGIRARD AVE SHUMBOLDTAVESINTERSTATE35WLAKESHOREDRS GRAND AVE SPLEASANT AVEJAMES AVE SINTERSTATE 35W± Location and Zoning Map 0 740 1,480370ft I:\GIS\Community Development\Case Maps\2025\WLNC Site Plan Approval - 6710 Lake Shore Dr.mxd 6710 Lake Shore Drive Case #:Z24-19 SUBJECTSITE Legend R Low Density Residential R-1 Single Family Residential PMR Planned Multi-Family MR-2 Multi-Family MR-3 High-Density Multi-Family C-1 Community Commercial C-2 General Commercial PC-2 Planned General Commercial PMU Planned Mixed Use Wood Lake Park Required Findings Wood Lake Nature Center / 6710 Lake Shore Dr Site Plan Approval (Subsection 547.13) In evaluating a site plan, the Planning Commission and Council shall consider its compliance with the following: a) Consistency with the various elements and objectives of the City’s long range plans including, but not limited to, the Comprehensive Plan. The City’s Comprehensive Plan designates this property as a Park. The Wood Lake Nature Center building itself is considered a “Community Facility.” The 2018 Parks Master Plan specifically memorialized that one of the community’s top park priorities identified during community engagement was the need for “a remodeled nature center to accommodate expanding programs.” Some of the recommendations provided in the plan for renovation or replacement of the facility included: more meeting space, more room for entertainment, a catering kitchen, laundry facility, ADA accessibility, classrooms, and expanded storage. Almost all of the recommendations are addressed by the proposed project. Further, the project also advances the following Parks System Comprehensive Plan objectives:  Preserve crucial public places like parks, recreation areas, open spaces, wetlands, and Wood Lake Nature Center.  Include criterion for all new park and facility improvements that improves sustainability of materials, energy use, operating cost and lifecycle replacement, and natural environmental impact.  Incorporate best practices for stormwater retention in new park development and in the renovation of existing parks.  Encourage parks to be naturalized with prairie grasses and pollinator-friendly plants, where suitable, to minimize maintenance costs and to beautify parks.  Provide all residents with access and the opportunity to be involved in recreation programs, regardless of age, culture and mobility level throughout the City.  Provide adequate seating, shade, trail lighting and a trail loops of varying lengths in parks to encourage active living for an aging population.  Provide parks and recreation facilities that are handicap accessible consistent with the Americans with Disabilities Act Accessibility Guidelines for Building and Facilities and universal design principles. b) Consistency with the purposes of the Zoning Code. The project is consistent with the R District regulations for nonresidential sites. All general building and performance standards will be specifically met or, as outlined in the policies section of the staff report, have been identified for Director modification and meet the intent of the ordinance. c) Preservation of the site in its natural state, insofar as practicable, by minimizing tree and soil removal, and designing any grade changes so as to be in keeping with the general appearance of neighboring developed or developing areas. While the building will be getting larger and closer to the street, which necessitates the removal of 75 existing trees; 13 trees (within the disturbed area) will be transplanted elsewhere on site, 14 new trees will be planted, and no significant changes in grade are proposed. d) Creation of a harmonious relationship of buildings and open spaces with the terrain and with existing and future buildings having a visual relationship to the proposed development. The proposed site layout is harmonious with the lake and the general terrain of the park. As mentioned in the staff report, the new building will be 40 feet further from the lake and 80 feet closer to the street. This helps to protect the shoreline of the lake while facilitating an improved pedestrian and user experience as soon as users enter the site. The parking lot will be “split” to accommodate a promenade-like entrance to the building with wide pedestrian walkways and landscaping. e) Creation of a functional and harmonious design for structures and site features including: i. Creation of an internal sense of order for the various functions and buildings on the site and provision of a desirable environment for occupants, visitors and the general community; The site layout is logical. The proposed pedestrian improvements and well-defined connection between the building and the street provide a generally desirable environment. ii. Appropriateness of the amount and arrangement of open space and landscaping to the design and function of the development; There is good design and function of open space, with various gathering spaces such as an amphitheater, lakeside deck, and children’s play area. Landscaping considers the context of the area and will include native drought-resistant plantings. Trees will be added to the landscape islands within the parking lot and will enhance pedestrian experience by providing shade. Perimeter plantings will also help to screen the parking lot from the street. Overall, while an appropriate amount of landscaping will be added, the terrain and natural biomes of the park help anchor the project with existing and lush surroundings. iii. Appropriateness of the materials, textures, colors and details of construction as an expression of the design concept of the project and the compatibility of the same with the adjacent and neighboring structures and functions; As a sustainably designed and highly energy efficient building, the details of construction are sensitive to and compatible with the area. Surrounded by forest, the building considers the context by remaining at one story and utilizing high quality exterior materials, in wood hues and natural tones. iv. Adequacy of vehicular, cycling and pedestrian circulation, including walkways, interior drives and parking, in terms of location and number of access points to the public streets, width of interior drives and access points, general interior circulation, separation of pedestrian, cycling and vehicular traffic and arrangement and amount of parking so as to be safe, convenient and, insofar as practicable, compatible with the design of proposed buildings, structures and neighboring properties. There will be adequate bike parking provided; twenty-three racks (46 spaces) at multiple entrances to the building. The pedestrian areas are also adequate with ADA access to both the west and east sides of the building. The arrangement of parking is safe, convenient and compatible with the building and surrounding park. The amount of parking is adequate. f) Creation of an energy-conserving design through design location, orientation and elevation of structures, the use and location of glass in structures, and the use of landscape materials and site grading. The development will meet Minnesota SB2030 energy reduction targets through the use of high performing building envelope systems, a traditional geothermal system, and a roof mounted solar photovoltaic array. g) Protection of adjacent and neighboring properties through reasonable provisions for such matters as surface water drainage, sound and sight buffers, preservation of views, light and air, and those aspects of design, not adequately covered by other regulations, which may have substantial effects on neighboring land uses. Adjacent properties are buffered from all the above by a significant amount of heavily forested land. WOOD LAKE NATURE CENTER Wood Lake Park is a 150-acre natural area dedicated to environmental education, wildlife observation, and outdoor recreation. The park features several wildlife viewing areas, an amphitheater, a picnic ground, and three miles of trail and boardwalks. The City of Richfield is working to replace its current outdated Nature Center building with a new facility. The project’s adjacency to wetlands and other ecological features means the building and site design are mindfully cautious in order to support, protect, and bolster native flora, fauna, and habitats while providing additional educational offerings and community space. The new site design modifies the existing parking lot to create a more visible and direct approach to the site and building entry which prioritizes pedestrian and bicycle circulation over passenger vehicles. By splitting the existing parking lot, the natural landscaping extends out to Lake Shore Drive, starting the immersive natural experience for visitors upon entering the site. Once on site, circulation includes a 12-foot-wide sidewalk that leads visitors from the street to the entry, additional paved paths on the street side of the building, and an ADA accessible path that circumnavigates the building providing easy access to the building and site amenities. The site design also includes a dry creek bed stormwater feature, a nature-based outdoor play space, a new 100-seat amphitheater, a lakeside deck, and natural plantings throughout. The new parking lot layout maximizes the number of spaces allowed under the zoning code (102 stalls) without expanding the footprint of the parking lot, even with the increase in building size. The existing parking lot (109 stalls), which was implemented prior to the current zoning requirements, was oversized based on the existing Nature Center’s square footage. With the new design more than seven stalls were eliminated with the split in the parking lot at the entry sequence to the building, but eight stalls were added to the vegetated island in the SE section of the parking lot to bring the total up to the maximum number of 102 stalls. Even with the added stalls the parking lot meets the requirement for 5% interior planting area and the redesign of the parking also reduced the impervious surface on site by 3,500 square feet. The parking stalls provided reflect both the code requirements and an appropriate number of spaces for daily use of the Nature Center including programming and events, as observed by staff. Considered in the parking lot design is the agreement with the Post Office for the contracted use of 14 stalls. The stalls are used for overnight parking and vacated during operating hours for the Nature Center and during scheduled large special events. The agreement with the Post Office is a source of revenue generation for the Nature Center. To better merge with its natural settings, the building is configured into small wings centered around a main entry and public exhibit space. With pockets of landscape captured by the building footprint, the outdoors extends inward to merge the indoor and outdoor environments. Expanding from its existing footprint of 6,225 SF to approximately 17,000S SF, the programming of the new building includes an improved lobby and entry experience, exhibits, lounge and conference spaces, multipurpose rooms for educational programming and rentals, staff office space, expanded restroom facilities, and rentals. The exterior material palette further suggests merging of the building with its natural surroundings by use of thermally modified wood for exterior cladding and prominent green roof forms above the large gathering spaces. The project will meet the rigorous Minnesota B3 guidelines and SB2030 energy reduction targets. Some of the features that will help achieve these goals are onsite stormwater management, native plantings, bird- friendly glazing, healthy material selection, high performing building envelope systems, a traditional geothermal system, and a roof mounted solar photovoltaic array. With the natural setting and the resilient low-maintenance goals of the Nature Center, underground mechanical irrigation is not planned for the project. As part of the Minnesota B3 guidelines, which must be met to comply with requirements connected to state funding the City has received, “No potable water shall be used for irrigation after a 5-year plant establishment period except for periods when actual rainfall for the month is less than 30% of the average rainfall for that month”. This means a permanent irrigation system is allowed by B3 but can only be used after the five-year establishment period if rainfall conditions are low. The use of native plantings which are drought tolerant after establishment eliminates the need for long-term irrigation. Hose bibs are located at consistent intervals around the building to maintain plantings in extreme drought conditions. Additionally, the building is located within a natural area without irrigation. Irrigating the building alone would negatively impact the natural feel of the park and the integration of the building into the landscape. Construction is set to being in the spring of 2025, completing in the spring/summer of 2026. T90 . 5 4 '50' WETLAND SETBACK50 'WOOD LAKEOHWL=820.7NOTES:1.SEE SHEET C001 FOR CIVIL NOTES AND LEGEND.ZONING INFORMATIONEXISTING ZONING: R - LOW-DENSITY RESIDENTIAL (PARKS)PROPOSED ZONING:R - LOW-DENSITY RESIDENTIAL (PARKS)ADJACENT ZONING:R-1 - SINGLE FAMILY RESIDENTIALPMR - PLANNED MULTI FAMILYPC-2 - PLANNED GENERAL COMMERCIALSETBACK SUMMARY: BUILDING:40' FRONT SETBACK30' SIDE/REAR SETBACKPARKING:20' SETBACK FROM PUBLIC RIGHT-OF-WAYSITE INFORMATION AREA (SF) AREA (AC) TOTAL SITE AREA 2,812,181 64.56DISTURBED AREA 143,355 3.29EXISTING IMPERVIOUS 117,433 2.70PROPOSED IMPERVIOUS 128,506 2.95PROPOSED IMPERVIOUS SITE COVERAGE 56%(INCLUDES OFFSITE AREAS)SCALE IN FEET04080PARKING INFORMATIONMAXIMUM PARKING REQUIREMENTS:BUILDING: 3.33 STALLS PER 1000 SF BUILDING AREABUILDING IS APPROXIMATELY 17,000 SF: 17,000 SF/(3.33/1000 SF) =57 STALLSAMPHITHEATRE: 1 STALL PER 3 SEATS, 1 STALL PER 800 SFSTAGE AREAAMPHITHEATRE HAS APPROX. 100 SEATS, STAGE AREAIS APPROX. 800 SF:100 SEATS/3 =34 STALLS800 SF STAGE =1 STALLTOTAL =92 STALLSMAX. ALLOWABLE = 110% OF TOTAL CALCULATED ABOVE92 STALLS*1.10 = 102 STALLSSTALLS PROVIDED:ACCESSIBLE STALLS 7STANDARD STALLS 95TOTAL STALLS 102HGA NO:DATE:NODESCRIPTIONDATECITY OF RICHFIELDWOOD LAKENATURE CENTERNOT FORCONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC.ISSUANCE HISTORY - THIS SHEETLAND USE SUBMITTALDECEMBER 16 20240969-005-0006710 LAKE SHORE DR SRICHFIELD, MN 55423OVERALL SITEPLANC002 WLNC - Parking Lot Count and Planting Requirements 01/02/2025 PARKING INFORMATION MAXIMUM PARKING REQUIREMENTS: BUILDING: 3.33 STALLS PER 1000 SF BUILDING AREA BUILDING IS APPROXIMATELY 17,000 SF: 17,000 SF/(3.33/1000 SF) =57 STALLS AMPHITHEATRE: 1 STALL PER 3 SEATS, 1 STALL PER 800 SF STAGE AREA AMPHITHEATRE HAS APPROX. 100 SEATS, STAGE AREA IS APPROX. 800 SF: 100 SEATS/3 =34 STALLS 800 SF STAGE =1 STALL TOTAL =92 STALLS MAX. ALLOWABLE = 110% OF TOTAL CALCULATED ABOVE 92 STALLS*1.10 = 102 STALLS STALLS PROVIDED: ACCESSIBLE STALLS 7 STANDARD STALLS 95 TOTAL STALLS 102 6287+3(563(&7,9(6287+3(563(&7,9()520%2$5':$/.1$785(3/$<3(563(&7,9(0$,1(175<3(563(&7,9(+*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$(;7(5,255(1'(5,1*6)255()(5(1&(21/<$XWKRU $%&'(5()(572$)250$7(5,$/,'&2'(65()(572$6(5,(6)25'225$1')5$0(7<3(6$1''(7$,/65()(572$6(5,(6)25:,1'2:$1'23(1,1*7<3(6'(9,&(6$5(',0(16,21('72&(17(5/,1(2)'(9,&(812+(,*+76$5()520))(/(9$7,21&21),50(;7(5,25%8,/',1*02817(''(9,&(6$1'),;785(6/2&$7,216:,7+6,',1*/$<28735,2572,167$//&(17(5'(9,&(21%2$5'&225',1$7(/2&$7,21:,7+$5&+,7(&7*(1(5$/127(6(;7(5,25(/(9$7,216/(9(/ 522) $6'1*6'1*6'1*:::::::::60)60)&217$7%$6(60)&217$7'$78060)&217$7%$6($$6(()25(/(9$7,21$7021,725$60)7<3$76,//$ :$//+<'5$176((3/80%&25(7(167((/&2/8016((6758&785$/29(5)/2:'2:163287$/(9(/ 522) 6'1*6(($6&5((1:$//6'1*60)60)&217$7'$7806'1*60)&217$7%$6(&25(7(167((/&2/8016((6758&785$/$$6,0)'.%)'&/(9(/ 522) $6'1*6'1*::::6'1*(;+,%,7522)021,725%(<21'60)&217$7%$6(60)60)&217$7'$780$6(()25$1*/('(/(9$7,2129(5)/2:'2:163287$$$60)7<3$76,///(9(/ 522) $9(*5%(<21'6'1*60)&217$7%$6(::::::::60)60)6(()25(/(9$7,21$7021,725 $60)&217$7'$7806'1*6'1*6(()25(/(9$7,21$7021,725$60)7<3$76,//$ 60)&217$7%$6(29(5)/2:'2:163287:$$$:'75(//,60(7)$%7232)%(1&+/(9(/ 522) $6'1*'$6+('/,1(,1',&$7(6&217,1286*8$5'5$,/$7(/(9$7(''(&.6'1*6'1*60)60)60)60)&217$7'$78060)&217$7%$6(6(()25(/(9$7,21$7021,725$60)7<3$76,// :$//+<'5$176((3/80%:::/(9(/ 522) $6'1*9(*59(*56'1*'(&.$1'*8$5'5$,/6(($60)60)60)60)60)6(($)25(/(9$7,216$7522)6'1*29(5)/2:'2:16328760)&217$7%$6( :$//+<'5$176((3/80%::::::::::::$),3&$7(;326(')281'$7,21%(/2:'(&.$&25(7(167((/&2/8016((6758&785$//(9(/ 522) 6'1*    6(( )25(/(9$7,21$7021,7256'1*60)6'1*6'1*60)&217$7'$78060)&217$7%$6(/95/95$60)&217$7%$6('$6+/,1(,1',&$7(66&5((1:$//6((6+((7$ $ $ $6(($1')25(/(9$7,216$7(;+,%,77(55$&( :$//+<'5$176((3/80%:29(5)/2:'2:1632876'1*%(1&+0(7)$%7232)%(1&+$$7%(1&+$/(9(/ 522) 6'1*6'1*60)'$6+/,1(,1',&$7(66&5((1:$//6((6+((7$60)&217$7%$6(60)&217$7'$780&25(7(13,3(&2/8016((6758&785$/29(5)/2:'2:163287:$//+<'5$176((3/80% $$6,0/(9(/ 522) 6'1*6'1*::::60)6'1*60)&217$7'$78060)&217$7%$6($60)7<3$76,// :$//+<'5$176((3/80%$/(9(/ 522) :6'1*6'1*60)6'1*60)&217$7'$78060)&217$7%$6(&25(7(13,3(&2/8016((6758&785$/60)7<3$76,//:'75(//,6/(9(/ 522) :6'1*60)6'1*60)&217$7'$78060)&217$7%$6(60)7<3$76,//6'1*/(9(/ 522) 6'1*60)6'1*60)7<3$76,//60)&217$7'$7806'1*60)&217$7%$6(:/(9(/ 522) 6'1*6'1*6'1*29(5)/2:'2:16328760)&217$7%$6(60)&217$7'$78060)::'75(//,6/(9(/ 522) 6'1*60)60)&217$7'$7806'1*6'1*60)&217$7%$6( $6(()25$1*/('(/(9$7,216'1*%(1&+:'75(//,60(7)$%7232)%(1&+$6,0$7%(1&+/(9(/ 522) 60)&217$7%$6(:6'1*6'1*3/&6(($+*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$(;7(5,25(/(9$7,216  (;7(5,25(/(9$7,21$7(175<($67  (;7(5,25(/(9$7,21$7(175<1257+  (;7(5,25(/(9$7,21$72)),&(1257+  (;7(5,25(/(9$7,21$708/7,385326(1257+($67  (;7(5,25(/(9$7,21$708/7,385326(1257+:(67  (;7(5,25(/(9$7,21$708/7,385326((;+,%,76287+($67  (;7(5,25(/(9$7,216287+  (;7(5,25(/(9$7,21$70(&+$1,&$/($67  (;7(5,25(/(9$7,21$72)),&(:(67  (;7(5,25(/(9$79(67,%8/(  (;7(5,25(/(9$72)),&(($67  (;7(5,25(/(9$7/281*(  (;7(5,25(/(9$7(;+,%,77(55$&(  (;7(5,25(/(9$7,21$7(;+,%,77(55$&(%(1&+  (;7(5,25(/(903'(&.(175< $%&'(5()(572$)250$7(5,$/,'&2'(65()(572$6(5,(6)25'225$1')5$0(7<3(6$1''(7$,/65()(572$6(5,(6)25:,1'2:$1'23(1,1*7<3(6'(9,&(6$5(',0(16,21('72&(17(5/,1(2)'(9,&(812+(,*+76$5()520))(/(9$7,21&21),50(;7(5,25%8,/',1*02817(''(9,&(6$1'),;785(6/2&$7,216:,7+6,',1*/$<28735,2572,167$//&(17(5'(9,&(21%2$5'&225',1$7(/2&$7,21:,7+$5&+,7(&7*(1(5$/127(6(;7(5,25(/(9$7,216522) $6'1*9(*560) 60)&217$7%$6(2):$//$7522)522) 6'1*60)&217$7%$6(2):$//$7522)60)$ 522) 6'1*6'1*:$60)&217$7%$6(2):$//$7522)   60)6,//60)522) $6'1*60) 60)&217$7%$6(2):$//$7522)522) 6'1*$6'1*   :60)&217$7%$6(2):$//$7522)60)60)6,//522)    6'1*6'1*60)60)&217$7%$6(2):$//$7522)6'1*6'1*60)6,//:$6,0/(9(/ 522) 6'1*60)&217$7'$7806'1*6'1*6(((/(96)25/2&$7,2160)&217$7%$6(60) 726,',1* 726,',1* $$$/(9(/ 522) 726,',1* 726,',1*:':52  6'1*$)66((:,1'2:7<3(660)&217$7'$7806'1*6'1*6(((/(96)25/2&$7,2160)7<3$76,//60)&217$7%$6(60)$$$$$$$596     )  )  )  )  )  )   %2$5'6 )   %2$5'6 )   %2$5'6 )   %2$5'6 )   %2$5'6 *   %2$5'6 *   %2$5'6 *   %2$5'6 *   %2$5'6 *   %2$5'6 6'1*!6'1*!6'1*! +*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$(;7(5,25(/(9$7,216$XWKRU  522)(/(9$7,21$7(;+,%,7($67  522)(/(9$7,21$708/7,385326($($67  522)(/(9$7,21$708/7,385326($1257+  522)(/(9$7,21$708/7,385326(%:(67  522)(/(9$7,21$708/7,385326(&1257+  522)(/(9$7,21$7(;+,%,76287+  (/(9$7,217<3,&$/6,',1*  (/(9$7,217<3$)6  6'1*721*8($1'*5229(6,',1*/$<287',$*5$0 $..//00$$$$&ϭϵ&ϮϬ&Ϯϭ&Ϯϭ5()(572$')/2253/$1$5($'1276+2:1)25&/$5,7<&ϯϮ&%87,/,7<<$5'$87,/,7<<$5'%87,/,7<<$5'&&ϭϵ$$$$&ϱϭ&ϱϭ$/7(51$7(612:0(/75()(572&29(56+((76'1*!)$&('6&5((1:$//60)!&217,18286&$3$76&5((1:$//[3267:,7+[+25,=217$/)5$0,1*)855,1*)256'1*$77$&+0(176((6758&785$/)25)5$0,1*6(&7,215 5     6'1*!)$&('6&5((1:$//60)!&217,18286&$3$76&5((1:$//[3267:,7+[+25,=217$/)5$0,1*)855,1*)256'1*$77$&+0(176((6758&785$/)25)5$0,1*6(&7,21  5    $%&'()*+,-./‡‡0$//,17(5,253$57,7,2166+$//%($D81/(66127('27+(5:,6(3/$1',0(16,216$5()520)$&(2)3$57,7,217<3($1''2127,1&/8'($33/,('),1,6+(681/(66127('27+(5:,6(3/$1',0(16,216,1',&$7('$6+2/'25&/($5',0(16,216$5()520)$&(2)$33/,('),1,6+,167$//:25.675$,*+73/80%/(9(/648$5($1'758(,13523(5$/,*10(17)/$71(66/(9(/)/225672758(3/$1(:,7+,1,1&+ 00 ,1 Ť 0 :+(17(67('%<7(1)227 0 675$,*+7('*(3/$&('$1<:+(5(21)/225,1$1<',5(&7,21&225',1$7()851,785(5(/$7('(/(&75,&$//$<287:,7+)851,785(9(1'25:+(5(+$1'5$,/6*5$%%$56&$%,1(76:$//02817(''225672362527+(5:$//+81*,7(06$5($77$&+('723$57,7,216,167$//%$&.(53/$7(6>25:22'%/2&.,1*@$&&85$7(/<326,7,21('$1'),50/<6(&85('720(7$/678'6:+(7+(52512768&+%$&.(53/$7(625%/2&.,1*$5(,1',&$7('21'5$:,1*6:+(5(1(::25.$%876$/,*1625$'-2,16(;,67,1*0$7(5,$/60$.(60227+$1'(9(175$16,7,21$1'(/,0,1$7((9,'(1&(2)3$7&+,1*$1'5(),1,6+,1*),1,6+1(::25.720$7&+$'-$&(1781',6785%('685)$&(681/(66127('27+(5:,6(&/26($1'3$7&++2/(6$1'23(1,1*6,1(;,67,1*)/225:$//$1'&(,/,1*:+,&+(;,67255(68/7)520'(02/,7,2125$/7(5$7,21:25.720$7&+$'-$&(1781',6785%('685)$&(635,2572&21&($/0(172)),5(5(6,67,9(0$7(5,$/6%<27+(5:25.3$7&+$1'5(3$,5$5($62)5(029('25'$0$*('$33/,('),5(3522),1*&203/(7(3$7&+,1*$1'5(3$,5720$,17$,1(;,67,1*),5(5(6,67$1&('(6,*1,1$&&25'$1&(:,7+),5(3522),1*0$18)$&785(5 6:5,77(1,16758&7,216)25&21',7,2162)(;32685($1',17(1'('86(&225',1$7(7(67,1*$1',163(&7,212)$66(0%/,(6$65(48,5('%<$87+25,7,(6+$9,1*-85,6',&7,213529,'(),5(67233,1*2)3(1(75$7,216$1'92,'67+528*+),5(5$7(':$//)/225$1'3$57,7,21$66(0%/,(6>$1'522)@,1&/8',1*(037<23(1,1*6$1'23(1,1*6&217$,1,1*&$%/(63,3(6'8&76&21'8,7$1'27+(5(/(0(1763529,'($//&2'(5(48,5('6,*1$*(6,*1!)252&&83$1&<0(&+$1,&$/(/(&75,&$/(7&&225',1$7(:,7+2:1(5 66,*1$*(9(1'25)25'(6,*1$1'0$7(5,$/,7<$76281'5$7('3$57,7,21:$//63529,'(&217,18286%($'2)$&2867,&$/6($/$17$7-81&785(2)%27+)$&(62)5811(56253/$7(6:,7+)/225$1'&(,/,1*&216758&7,21$1':+(5(9(5*<3680%2$5'$%876',66,0,/$50$7(5,$/6$723(1,1*6$1'&872876),//23(163$&(6%(7:((1*<3680%2$5'$1'),;785(6&$%,1(76'8&76$1'27+(5)/86+253(1(75$7,1*,7(06:,7+&217,18286%($'2)6($/$176($/6,'(6$1'%$&.62)(/(&75,&$/%2;(672&203/(7(/<&/26(2))23(1,1*6$1'-2,1763529,'($&&(663$1(/6$3!$65(48,5(')25$&&(66720(&+$1,&$/$1'3/80%,1**(1(5$/127(6)/2253/$1/(9(/ 522) $ $6'1* 6'1*/(9(/ 522)  6'1*/(9(/ 522) $ 6'1*6'1*/(9(/ 522)  6'1*+*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5.(<3/$1$5($'/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$87,/,7<<$5'3/$1 '(7$,/6$XWKRU  87,/,7<6&5((1:$//.(<127(6)/2253/$1 'HVFULSWLRQ) '$6+('/,1(,1',&$7(6('*(2)522)2562)),7$%29() &$7(5,1*:$50,1*&$576127,16&23() )/225'5$,16((3/80%,1*) ),5($/$50$1181&,$7253/$1(/5()(572),5(3527(&7,21) '225$&78$725/2&$7,215()(572+$5':$5(*52836,1'2256&+('8/() 5(&(66(':$//&$%,1(781,7+($7(56((0(&+$1,&$/) ),5('(3$570(17&211(&7,216(((;7(5,25(/(9$7,216$1'5()(572),5(3527(&7,21) :$//02817352-(&7256((7(&+12/2*<) 3529,'('8$/6,'('(/(&75,&),5(3/$&() 5$',$17)/2250$1,)2/'6((0(&+$1,&$/) (;7(5,25+26(%,%6((3/80%,1*) $9(4!&(,/,1*+81*02725,=('352-(&7,216&5((16((5&3) 2:6!23(5$%/(:$//6<67(0) 6+(/9,1*%<2:1(5 2)2, ) 021,725',63/$<$1'%5$&.(76((7(&+12/2*<) 5(86((;,67,1*,17(5,25),5(3/$&()25(;7(5,25$33/,&$7,21)/8($77$&+('723(5*2/$$1'72(;7(1'72&2'(5(48,5('+(,*+7%(<21'522)1(:+,*+%$6($7',$2872)6721(0$6215<720$7&+/$1'6&$3,1*) &(,/,1*+81*&25'5((/&(17(5('29(5,6/$1'6(((/(&$1'5&3) 3529,'(  &2/25&+$1*,1*/('/,*+7(':$//3$1(/6$1'&2/25&+$1*,1*/('&29(/,*+7$7833(53(5,0(7(52)5220) (/(&75,&$/(48,30(176(((/(&75,&$/) 75$6+%,1%<2:1(5) 5(&<&/,1*%,1%<2:1(5) :$//02817(':$6+'2:167$7,216((3/80%,1*) :$//02817(''5<,1*5$&. 2)&, ) 7$1.6$1'6758&785(%<(;+,%,7'(6,*1(56(((;+,%,73/$16) :$//028173+21(6(((/(&) 02%,/(612:6+2(5$&.6 2)2, ) 02%,/(,6/$1' 2)2, ) 23(1$5($)25$//7(55$,1:+((/&+$,53$5.,1* 2)2, $1'&+$5*,1*) 0(7)$%!%(1&+723:,7+6'*1!)$&(6(($) )/2256,1.6((3/80%,1*) )'.%!),5('(3$570(17.(<%2;)25),5('(3$570(17$&&(66) )/225&23,(52)2,) :25.%(1&+2)2,) 0236,1.6((3/80%,1*) 87,/,7<6,1.6((3/80%,1*) 67$,1/(6667((/:25.,6/$1'2)2,) 0.%'!&)&,6(($6(5,(6(/(9$7,216)257<3() (;+,%,7'(6,*1%<27+(56) (/(&75,&:$7(5&22/(5:,7+%277/(),//(56((3/80%,1*) 0)3/!(/(&75,&),5(3/$&(81,7) :$//23(1,1*672$&&(37(;+,%,77$1.6$1'',63/$<6%<(;+,%,7'(6,*1(5) 3529,'()8//+(,*+73/$<:22'%$&.(5217+,6:$//2525,(17:$//:,7+6+($7+,1*7+,66,'($76+($5:$//&21',7,21:$//02817('(;+,%,7%<27+(56) &867200,//:25.%(1&+:6725$*(%(/2:)$%5,&!$1'83+!&86+,216(($6(5,(6) '8$/+(,*+7&2$7+22.6&+!(17,5(/(1*7+2):$//,1',&$7(') '225$&78$725$1'&$5'5($'(502817('7267/78%(%2//$5'+3&!),1,6+6((6+((7$) 67((/6+,36/$''(50(7)$%!3$,17),1,6+) 672236((6758&785$/) 5(&(66('6833/<*5,//(&225',1$7(/2&$7,21:,7+0(&+$1,&$/$1'6758&785$/) $67!$&2867,&$/:$//3$1(/66((6+((76(5,(6$(/(9$7,216)257<3(6) 67((/&2/8016((6758&785$/3$,17+3&!) 6'1*!$7:$//5(785172:,1'2:) 6'1*!$7:$//5(785172:,1'2:  (/(9$7,2187,/,7<6&5((1:$//6287+  (/(9$7,2187,/,7<6&5((1:$//:(67  (/(9$7,2187,/,7<6&5((1:$//($67  (/(9$7,2187,/,7<6&5((1:$//1257+ BB B9(67,%8/(9(67,%8/($1,0$/&$5((;+,%,7/2%%<0(&+$$&21)5(17$//281*(%0(&+$1,&$/)$0,/<7/7(/(&7(/&20:$7(50$,17(1$1&($9$%&'((./0)*+    /281*($2)),&(&21)%6725:25.63$&(.,7&+(1(77(2)),&(67$))72,/(75(&(37,216(1625<08/7,385326(&08/7,3853326(%08/7,385326($6725*5283(175<+3&/6767256725+3&/67+3&/67&$7(5,1*5(6752206/$&7$7,21)$0,/<55&,5&&,5&5(17$/6725&8676725$*(352*5$06725$*(75$6+5(&<&/,1*2)),&(2)),&(2)),&(+3&/67+3&/6723(12)),&(67$))(175<)(($-,5()(572$)25(1/$5*(''(&.3/$1$5($&$5($%$5($& $5($%$5($$$5($%$5($$$5($%$5($'$5($&$5($'$5($&$/7(51$7(612:0(/76,7(6+2:1)25&217(;721/<5()(572&,9,/$1'/$1'6&$3('5$:,1*6287'2256($7,1*$5($287'2256($7,1*$5($+*$12'$7(12 '(6&5,37,21 '$7(&,7<2)5,&+),(/':22'/$.(1$785(&(17(5127)25&216758&7,21‹&23<5,*+7+$00(/*5((1$1'$%5$+$0621,1&,668$1&(+,6725<7+,66+((7/$1'86(68%0,77$/'(&(0%(5.(<3/$1$5($$$5($%$5($'$5($&/$.(6+25('565,&+),(/'0130 &?8VHUV?DFNDLWOLQV?'RFXPHQWV?5HYLW/RFDO)LOHV?$B:RRG/DNH1DWXUH&HQWHUBBNVFKDORZ.&:$UYW$)/2253/$129(5$//$XWKRU  )/2253/$129(5$// GAS18" RCP ST S15" RCPUGEUGEUGEUGEUGEUGEB I T U M I N O U SB I T U M I N O U SGRAVELPATHB I T U M I N O U SB I T U M I N O U SB I T U M I N O U SGRAVELGRAVELGRAVELCONCRETEBITUMINOUSCONCRETECONCRETECONCRETECONCRETEBITUMINOUSCONCRETE WALL6 FT WOOD FENCE6 FT CHAIN LINK FENCE6 FT CHAIN LINK FENCECONCRETESHORE LINE PER PLATBENCHESEMBENCHSIGNEMHPKSPKSPKSPKSSIGNMBSIGNSIGNEMHHHFPKSPKSPKSPKSPKSPKSPKSPKSPKSPKSPKSSIGNTRANSSIGNSIGNWVTLWVHYDWVWVPKSPKSSIGNBENCHBENCHBENCH825835835830830835840845850845845840835830835840830830830830825825825830830830830830835835835824824823826829826827828829831827826829828824828827826823822822823824826827828828823822824822823824824823826826828828827828829827829829829828829827827831831833832831833832831834833832831831832832831829828827827828829829828829831828829822823824826849848847846844843842841839838837836834833832831833834836837838839841842837838839836843841842844846847848849834833832831836827832WOOD LAKEWETLANDLAKE SHORE DRIVEEXISTING PARKING LOTEXISTING TRAILEXISTING PARKING LOT1OHWL BUFFERWETLAND BUFFERWOOD LAKEWETLANDLAKE SHORE DRIVEEXISTING TRAILOHWL BUFFERWETLAND BUFFERPROPERTY LINE111111100010011787100410031002100810061007100910101005ONLY THOSE PERSONS AUTHORIZED BY THE CITY MAY REMOVE ANY TREES FROM PUBLIC LAND. TREES REMOVED FROM ANY PUBLIC LAND INCLUDING CITY, COUNTRY OR STATE RIGHT-OF-WAY SHALL BE REPLACED BY THE PERSON OR ENTITY WHO REMOVED IT. REPLACEMENT SHALL BE IN THE FOLLOWING MANNER: A. REPLACEMENT OF ANY LIVE TREE WHICH IS REMOVED FROM ANY PUBLIC LAND SHALL BE REQUIRED ON A CALIPER INCH FOR CALIPER INCH BASIS. THE CITY MAY ALSO ELECT TO RECEIVE CASH IN LIEU OF TREES BASED ON FREE PER CALIPER INCH DETERMINED BY THE CITY COUNCIL.B. REPLACEMENT TREES SHALL BE OF SPECIES APPROVED BY THE CITY FORESTER. GENERAL NOTES - TREE REMOVALLEGEND - TREE REMOVALEXISTING TREE TO BE TRANSPLANTEDEXISTING TREE TO BE REMOVEDEXISTING TREE TO BE PROTECTEDLIMITS OF CONSTRUCTIONHGA NO:DATE:NO DESCRIPTIONDATECITY OF RICHFIELDWOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC.ISSUANCE HISTORY - THIS SHEETLAND USE SUBMITTALDECEMBER 16, 20240969-005-006710 LAKE SHORE DR SRICHFIELD, MN 5542312/12/2024 2:08:56 PM C:\Users\laluken\Documents\Revit Local Files\L24_Wood Lake Nature Center_0969-005-00_LNicholsLR7H9.rvtL100OVERALL TREEPROTECTIONPLANAuthor1" = 30'-0"1OVERALL TREE PROTECTION PLANKEYNOTES - TREE PROTECTION# DESCRIPTION1 TREE PROTECTION FENCING, TYP. REFER TO DETAILS ON SHEET L120TYP.TYP.TYP.TREE TRANSPLANT SCHEDULEKEY TREE SPECIES TREE SIZE HEALTH1000 MAPLE 4" CAL. GOOD1001 MAPLE 4" CAL. GOOD1002 MAPLE 2" CAL. GOOD1003 MAPLE 3" CAL. GOOD1004 MAPLE 2" CAL. GOOD1005 MAPLE 4" CAL. GOOD1006 MAPLE 4" CAL. GOOD1007 MAPLE 4" CAL. GOOD1008 MAPLE 2" CAL. GOOD1009 MAPLE 2" CAL. GOOD1010 MAPLE 2" CAL. GOOD1011 MAPLE 2" CAL. GOOD1787 RED MAPLE 4.5" CAL. GOOD 830 830 835825 8 2 5 8 3 0 8 3 0 830 835 826 8 2 7 828 823 822824 8 2 2 823 824 824 823 826 8 2 6 8288 27828829 8 2 7 8 2 9 8 2 9 829 828 8328 3 3 832 831 8 3 1 8 3 2 832826 8368 3 4 8 3 3 8 3 2 831 1 2 3 6 10 12 13 14 3 4 5 6 6 7 8 8 8 9 15 11 11 6 6 16 6 7 8 8 8 8 8 11 EXISTING PARKING LOT 17 17 17 17 17 WETLANDWETLAND 8 88 8 8 8 8 8 8 8 6 18 TYP. 18 TYP. 18 TYP. CONC FIN-32 CONC FIN-32 PVR-1 SITE-1 SITE-2 STN-1 STN-1 STN-1 STN-1 STN-1 STN-1 STN-1 STN-2 STN-3 STN-3 STN-4 TYP. STN-5 TYP. STN-6 STN-7 TYP. STN-8 TYP. FURN-1 TYP. FURN-1 TYP. 19 19 19 19 19 19 22 25 24 24 TYP. 26 26 26 26 26 26 1 L210 1 L220 3 L220 2 L220 4 L220 6 L220 9 L220 27 28 28 12 L220 12 L220 12 L220 12 L220 L221 1 5 L220 8 L220 7 L220 1. UTILIZE "CALL 811" UTILITY LOCATION PRIOR TO ALL EXCAVATION ACTIVITY. 2. REFER TO CIVIL DRAWINGS FOR ADDITIONAL SITE INFORMATION 3. CONTRACTOR TO OBTAIN DIGITAL DRAWING FILE FOR LAYOUT OF LOCATION VERIFICATION OF ALL SITE AND LANDSCAPE FEATURES 4. CONTRACTOR RESPONSIBLE FOR VERIFYING ALL QUANTITIES 5. CONTRACTOR RESPONSIBLE FOR COORDINATING ALL WORK WITH ADJACENT GOLF COURSE WORK. 6. CONTRACTOR TO FIELD COORDINATE PLACEMENT/LAYOUT OF BOULDERS WITH LANDSCAPE ARCHITECT PRIOR TO INSTALLATION. GENERAL NOTES LEGEND C.I.P. CONCRETE SURFACING SEE CIVIL NARRATIVE STONE SURFACING 1 SEE SPEC. 321540 STONE SURFACING 2 SEE SPEC. 321540 STONE STEP 1 REFER TO SPEC. 321540 STONE SEAT WALL REFER TO SPEC. 321540 STEEL EDGING REFER TO SPEC. 321540 BOULDER 1 REFER TO SPEC. 321540 STONE SURFACING 3 SEE SPEC. 321540 BOULDER 2 REFER TO SPEC. 321540 ENGINEERED WOOD FIBER SURFACING SEE SPEC. 321540 PAVER SURFACING 1 SEE SPEC. 321540 BIKE RACK REFER TO SPEC. 321540 SITE FURNISHINGS BY OWNER FLAGSTONE REFER TO SPEC. 321540 LIMITS OF CONSTRUCTION LIGHITNG REFER TO CIVIL DWGS. TABLE & CHAIRS FF&E BIKE RACK REFER TO SPEC. 321540 EXISTING TREE KEYNOTES # DESCRIPTION 1 REINFORCED CONCRETE DRIVE; REFER CIVIL DWGS. 2 DRY CREEK; REFER CIVIL DWGS. 3 BICYCLE PARKING; REFER TO SPEC. 321540 4 EV CHARGING STATIONS; REFER TO CIVIL & ELECTRICAL DWGS. 5 SIGNAGE; PROVIDE 12" DIA. C.I.P. CONCRETE SONOTUBE FOOTINGS TO FROST; TYP. FOR ALL SIGNAGE; LOCATIONS TO BE FINALIZED IN CD; PROVIDE 10 QUANTITY; PROVIDE ELECTRICAL HOOKUP FOR (1) SIGN 6 EXISTING TREES, SAVE & PROTECT 7 FENCE;MECHANICAL YARD 8 PLANTING AREA 9 SALVAGED EXISTING FIREPLACE; REFER TO ARCH. DWGS. 10 FIRE PIT; FF&E 11 KIOSK, TYP; PROVIDE 12" DIA. C.I.P. CONCRETE SONOTUBE FOOTING TO FROST 12 NATURE PLAY AREA 13 SALVAGED EXISTING WOOD TRUNK, SEE SPEC. 310000 14 BIRD FEEDING & OBSERVATION AREA 15 SALVAGED DONOR BENCH, TYP. 16 TRANSFORMER; REFER TO ELEC. DWGS. 17 BLDG. OVERHANG 18 LUMINAIRE; REFER TO LIGHTING DWGS. & E500 19 STORMWATER OVERFLOW; REFER TO PLUMBING DWGS. 22 WETLAND BUILDING SETBACK 23 EX. TRAIL; REFER TO CIVIL DWGS. 24 EX. SITE FEATURE; REFER TO CIVIL DWGS. 25 ORDINARY HIGH WATER LINE BUILDING SETBACK 26 UTILITY FEATURE; REFER CIVIL DWGS. 27 AMPHITHEATER; REFER TO L210 FOR DETAILS 28 ADD ALTERNATE #1, SNOW MELT; REFER TO MECH. DWGS. 1/16" = 1'-0"1 Layout and Materials Plan HGA NO: DATE: NO DESCRIPTION DATE CITY OF RICHFIELD WOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC. ISSUANCE HISTORY - THIS SHEET LAND USE SUBMITTAL DECEMBER 16, 2024 0969-005-00 I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED LANDSCAPE ARCHITECT UNDER THE LAWS OF THE STATE OF MINNESOTA NAME: DATE: REGISTRATION NUMBER: 6710 LAKE SHORE DR S RICHFIELD, MN 55423 12/12/2024 2:09:11 PM C:\Users\laluken\Documents\Revit Local Files\L24_Wood Lake Nature Center_0969-005-00_LNicholsLR7H9.rvtL201 LAYOUT & MATERIALS PLAN Author0 16'64'32' 83083083582582583083083083582682782882382282482282382482482382682682882782882982782982982982883283383283183183283282683683483383283124322222EXISTING PARKING LOT33333WETLANDWETLAND25TYP. 5TYP. 5TYP. 986677777711010ViJ / 16AgA / 2AgACcNTRANS / 5TRANS / 5TRANS / 3ViJ / 5ViJ / 16ViP / 3CcN / 2AgA / 1CaC / 2IlV / 20FoM / 11CsB / 33ViT / 9LEGEND - PLANTINGBEE LAWNREFER TO SPEC. 329219UPLAND SHORTGRASS PRAIRIE SEED MIXREFER TO SPEC. 329219STEEL EDGINGREFER TO SPEC. 321540LIMITS OF CONSTRUCTIONLIGHITNGREFER TO CIVIL DWGS. TABLE & CHAIRSFF&EBIKE RACKREFER TO SPEC. 321540WOODLAND SEED MIXREFER TO SPEC. 329219WETGRASS PRAIRIE SEED MIXREFER TO SPEC. 329219NO MOW FESCUEREFER TO SPEC. 329219EXISTING TREEORNAMENTAL NATIVE PLANTINGS#1 CTNR. O.C. PERENNIALS; CATMINT, PRAIRIE DROP SEED, LITTLE BLUE STEM, OR SIMILAR; REFER TO SPEC. 3290001. UTILIZE "CALL 811" UTILITY LOCATION PRIOR TO ALL EXCAVATION ACTIVITY.2. REFER TO L440 FOR PLANT MATERIAL SCHEDULE3. REFER TO L200s & CIVIL DRAWINGS FOR ADDITIONAL SITE INFORMATION. 4. CONTRACTOR TO OBTAIN DIGITAL DRAWING FILE FOR LAYOUT AND LOCATION VERIFICATION5. CONTRACTOR RESPONSIBLE FOR VERIFYING ALL QUANTITIES. GENERAL NOTES - PLANTING PLAN1/16" = 1'-0"1PLANTING PLANHGA NO:DATE:NODESCRIPTIONDATECITY OF RICHFIELDWOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC.ISSUANCE HISTORY - THIS SHEETLAND USE SUBMITTALDECEMBER 16, 20240969-005-00I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED LANDSCAPE ARCHITECT UNDER THE LAWS OF THE STATE OF MINNESOTANAME:DATE:REGISTRATION NUMBER:6710 LAKE SHORE DR SRICHFIELD, MN 5542312/12/2024 2:09:37 PM C:\Users\laluken\Documents\Revit Local Files\L24_Wood Lake Nature Center_0969-005-00_LNicholsLR7H9.rvtL401PLANTING PLANAuthor016'64'32'KEYNOTES - PLANTING# Description1 TRANSFORMER, REFER TO ELEC. DWGS.2 EXISTING TREES, SAVE & PROTECT3 BLDG. OVERHANG4 BIRD FEEDING & OBSERVATION AREA5 LUMINAIRE; REFER TO LIGHTING DWGS. & E5006 EX. SITE FEATURE; REFER TO CIVIL DWGS.7 UTILITY FEATURE; REFER CIVIL DWGS.8 ORDINARY HIGH WATER BUILDING SETBACK9 WETLAND BUILDING SETBACK10 SCREENING HEDGE 830830828829829828CcN / 3CeOCeO1. UTILIZE "CALL 811" UTILITY LOCATION PRIOR TO ALL EXCAVATION ACTIVITY.2. REFER TO L440 FOR PLANT MATERIAL SCHEDULE3. REFER TO L200s & CIVIL DRAWINGS FOR ADDITIONAL SITE INFORMATION. 4. CONTRACTOR TO OBTAIN DIGITAL DRAWING FILE FOR LAYOUT AND LOCATION VERIFICATION5. CONTRACTOR RESPONSIBLE FOR VERIFYING ALL QUANTITIES. GENERAL NOTES - PLANTING PLANLEGEND - PLANTINGBEE LAWNREFER TO SPEC. 329219UPLAND SHORTGRASS PRAIRIE SEED MIXREFER TO SPEC. 329219STEEL EDGINGREFER TO SPEC. 321540LIMITS OF CONSTRUCTIONLIGHITNGREFER TO CIVIL DWGS. TABLE & CHAIRSFF&EBIKE RACKREFER TO SPEC. 321540WOODLAND SEED MIXREFER TO SPEC. 329219WETGRASS PRAIRIE SEED MIXREFER TO SPEC. 329219NO MOW FESCUEREFER TO SPEC. 329219EXISTING TREEORNAMENTAL NATIVE PLANTINGS#1 CTNR. O.C. PERENNIALS; CATMINT, PRAIRIE DROP SEED, LITTLE BLUE STEM, OR SIMILAR; REFER TO SPEC. 329000HGA NO:DATE:NODESCRIPTIONDATECITY OF RICHFIELDWOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC.ISSUANCE HISTORY - THIS SHEETLAND USE SUBMITTALDECEMBER 16, 20240969-005-00I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED LANDSCAPE ARCHITECT UNDER THE LAWS OF THE STATE OF MINNESOTANAME:DATE:REGISTRATION NUMBER:6710 LAKE SHORE DR SRICHFIELD, MN 5542312/12/2024 2:09:38 PM C:\Users\laluken\Documents\Revit Local Files\L24_Wood Lake Nature Center_0969-005-00_LNicholsLR7H9.rvtL410ENLARGEDPLANTING PLANAuthor1/8" = 1'-0"1ENLARGED PLANTING PLAN - PARKING ISLANDKEYNOTES - PLANTING# Description1 TRANSFORMER, REFER TO ELEC. DWGS.2 EXISTING TREES, SAVE & PROTECT3 BLDG. OVERHANG4 BIRD FEEDING & OBSERVATION AREA5 LUMINAIRE; REFER TO LIGHTING DWGS. & E5006 EX. SITE FEATURE; REFER TO CIVIL DWGS.7 UTILITY FEATURE; REFER CIVIL DWGS.8 ORDINARY HIGH WATER BUILDING SETBACK9 WETLAND BUILDING SETBACK10 SCREENING HEDGE 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.1 0.1 0.1 0.1 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 2.0 2.4 0.5 1.7 2.3 2.7 2.7 0.5 0.7 0.8 1.0 1.3 1.6 2.0 2.1 2.1 0.4 0.5 0.6 0.7 0.8 0.9 1.2 1.4 1.5 1.5 1.3 0.9 0.4 0.5 0.5 0.5 0.6 0.7 0.9 1.0 1.2 1.2 1.1 0.8 0.5 0.4 0.5 0.5 0.5 0.5 0.5 0.6 0.7 0.8 1.0 1.1 1.0 0.8 0.6 0.5 0.5 0.5 0.5 0.5 0.5 0.6 0.7 0.8 0.9 1.0 1.0 0.9 0.5 0.6 0.6 0.6 0.5 0.5 0.5 0.6 0.7 0.8 0.9 1.0 1.0 1.0 0.9 0.7 0.8 0.8 0.7 0.6 0.6 0.6 0.6 0.7 0.8 0.9 1.0 1.1 1.2 1.3 1.2 0.7 0.7 0.9 1.0 1.1 1.0 0.9 0.8 0.7 0.7 0.8 0.9 0.9 1.1 1.3 1.5 1.8 1.7 0.5 0.9 1.3 1.5 1.5 1.4 1.2 1.1 1.0 0.9 0.9 0.9 1.0 1.2 1.5 2.0 2.2 2.0 0.4 0.9 1.6 2.1 2.2 2.2 1.8 1.5 1.3 1.1 1.0 1.0 1.1 1.3 1.8 2.6 2.8 0.3 0.3 0.5 1.1 2.1 2.5 2.0 1.6 1.3 1.1 1.1 1.2 1.5 2.1 2.8 0.3 0.4 0.4 0.5 0.8 2.6 2.3 1.8 1.4 1.2 1.1 1.2 1.5 2.0 2.4 0.3 0.4 0.5 0.6 0.6 0.7 1.2 1.8 1.6 1.2 1.0 1.0 1.1 1.4 1.9 0.3 0.5 0.6 0.7 0.8 0.8 0.7 0.7 0.7 0.7 1.3 0.3 0.4 0.5 0.7 0.9 1.1 1.1 0.8 0.3 0.4 0.3 0.5 0.6 0.9 1.2 1.5 1.5 0.3 0.4 0.5 0.8 1.1 1.6 1.9 0.4 0.5 0.7 1.0 1.4 2.2 2.5 0.4 0.5 0.6 0.8 1.2 1.8 2.6 0.4 0.4 0.5 0.7 0.9 1.3 1.9 2.5 0.4 0.5 0.6 0.7 0.9 1.3 1.9 0.4 0.5 0.5 0.6 0.7 0.8 1.1 1.4 0.5 0.5 0.6 0.6 0.6 0.6 0.7 0.4 0.6 0.6 0.7 0.6 0.6 0.5 0.4 0.4 0.5 0.7 0.8 0.8 0.8 0.6 0.3 2.0 0.6 0.5 0.6 0.9 1.1 1.2 1.1 0.7 1.1 0.8 0.6 0.6 0.8 1.1 1.5 1.7 1.6 0.8 1.4 0.6 0.6 0.6 0.8 1.1 1.6 2.1 2.2 1.8 0.6 0.6 0.8 1.1 1.5 2.2 2.8 2.6 0.7 0.8 1.0 1.3 1.8 2.4 3.1 2.1 1.0 0.9 1.1 1.4 1.9 2.3 2.1 2.6 2.5 1.2 1.1 1.3 1.6 2.0 2.8 0.9 1.1 1.6 2.3 0.9 1.2 1.6 2.0 0.9 0.9 1.2 1.4 0.8 0.9 1.0 1.0 0.7 0.7 0.7 0.5 0.5 0.4 0.8 0.9 1.0 0.9 0.7 1.0 1.1 0.9 0.6 0.7 1.0 1.2 1.3 1.1 0.9 0.5 0.7 1.1 1.3 1.6 1.6 1.5 1.0 0.3 0.6 1.1 1.4 1.8 2.0 2.1 1.5 0.6 1.0 1.3 1.8 2.3 2.8 2.6 1.4 1.1 1.2 1.6 2.0 2.8 1.6 1.3 1.3 1.3 1.6 2.1 1.0 1.3 1.2 1.2 1.5 1.6 1.1 1.2 1.3 1.2 1.0 1.1 1.3 1.3 1.5 1.2 0.7 1.4 1.6 1.7 1.1 0.3 1.4 1.8 2.2 1.1 1.5 2.0 2.7 1.1 1.6 2.3 3.8 1.1 1.6 2.2 1.1 1.5 1.9 1.0 1.4 1.7 1.9 1.2 1.3 1.4 0.5 1.0 1.0 1.0 0.5 0.7 0.6 0.9 1.8 1.7 0.6 0.1 2.0 1.6 0.5 0.1 0.1 0.1 1.9 0.1 0.1 1.9 2.5 2.6 2.3 1.9 2.8 2.2 1.8 2.3 1.5 3.1 1.5 2.3 1.0 2.9 2.1 4.8 3.0 2.9 2.3 2.1 2.1 1.7 3.2 2.5 2.5 2.3 2.2 1.8 1.7 5.9 1.9 1.8 1.9 2.5 2.3 2.3 2.1 1.8 2.1 2.4 2.0 0.3 0.8 0.2 0.3 0.3 0.5 0.8 2.0 0.1 0.2 0.2 0.2 0.3 0.3 0.4 0.5 0.8 1.6 0.1 0.1 0.2 0.2 0.2 0.3 0.4 0.4 0.5 0.6 0.8 1.2 2.1 6.2 0.2 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.6 0.7 0.9 1.0 1.2 1.6 1.8 0.1 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.0 1.2 1.4 1.5 1.5 1.0 0.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.5 0.7 0.9 1.3 1.6 1.9 2.0 1.8 0.3 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.1 1.6 2.1 2.5 2.7 2.4 1.1 0.1 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.2 1.8 2.4 3.0 3.2 2.9 0.3 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.8 1.2 1.8 2.4 3.0 3.1 0.7 0.2 0.1 0.1 0.1 0.2 0.3 0.4 0.5 0.7 1.1 1.5 2.1 2.6 1.2 0.1 0.1 0.1 0.2 0.2 0.3 0.4 0.6 0.9 1.2 1.9 2.6 0.3 0.2 0.2 0.2 0.3 0.4 0.5 0.9 3.3 0.7 0.7 0.3 0.9 0.7 1.0 4.5 6.6 7.4 3.2 7.4 3.7 4.4 7.2 6.3 7.2 6.8 6.4 7.7 4.6 2.8 7.0 6.4 3.1 1.6 2.5 2.0 5.1 7.0 8.0 7.9 7.9 7.6 7.2 3.1 5.0 2.5 1.0 0.5 5.1 8.4 2.9 1.0 1.0 5.5 8.1 6.7 4.6 7.4 8.3 7.2 7.2 5.7 0.1 0.2 1.5 2.9 0.6 0.2 0.1 1.0 2.5 0.5 1.2 4.2 3.5 0.8 0.2 0.3 0.6 0.3 2.4 8.4 8.3 2.1 0.3 0.3 1.1 1.1 1.7 6.2 5.8 0.2 1.7 6.8 6.3 1.5 0.9 0.9 0.4 2.5 8.4 8.2 4.8 6.4 2.1 1.0 3.2 3.7 8.5 8.3 3.5 0.4 1.9 6.4 8.7 6.4 4.6 1.1 0.6 1.1 1.4 6.2 8.3 3.5 1.1 0.3 0.7 0.9 3.7 6.7 2.9 1.6 2.1 0.3 0.7 3.7 0.9 0.4 0.2 1.1 2.9 7.5 7.9 4.8 0.6 1.6 2.8 0.6 0.3 0.6 0.3 0.2 0.5 4.4 8.4 7.3 5.2 2.0 1.1 1.0 0.5 0.2 0.1 0.1 0.3 0.6 0.7 4.4 8.3 5.1 0.2 0.3 0.1 0.1 0.1 0.3 2.7 5.3 2.4 1.3 2.2 2.4 0.8 0.2 0.1 0.7 2.0 6.8 7.8 5.3 0.7 1.8 0.8 0.2 0.4 3.9 8.2 6.9 6.5 2.7 0.7 1.0 0.3 0.6 5.2 8.1 5.5 1.3 1.8 2.3 0.3 0.6 2.0 3.4 1.6 2.4 0.7 0.7 0.6 1.3 1.9 2.3 1.5 2.2 2.0 0.8 1.0 1.9 0.2 0.2 0.3 7.5 8.6 9.7 8.5 8.8 7.4 8.7 7.5 6.5 5.5 2.5 3.1 5.2 6.4 7.1 5.7 1.0 0.2 1.3 5.4 3.1 0.9 1.0 1.1 1.8 3.2 2.0 0.3 1.0 4.6 2.6 1.7 4.6 1.8 0.8 0.9 0.5 1.6 5.0 2.1 2.2 4.3 1.2 0.6 0.9 0.8 2.3 4.9 0.7 0.4 0.3 0.8 0.5 0.3 1.9 1.5 0.8 2.7 2.2 1.8 2.1 2.0 2.3 2.0 2.7 2.6 2.2 0.6 1.1 2.0 2.8 2.6 0.4 0.4 1.8 1.7 1.4 1.1 1.9 2.8 2.7 2.4 0.4 0.4 1.2 2.1 1.7 4.3 1.8 1.5 1.7 2.2 1.8 2.1 1.4 1.0 1.9 2.2 2.2 0.4 0.4 0.4 1.5 2.2 2.1 1.7 2.0 2.0 1.2 1.0 1.4 1.5 3.2 1.7 1.9 1.4 1.2 1.7 2.1 2.0 4.6 2.1 2.1 1.2 0.7 0.5 0.4 0.4 1.9 2.3 1.9 1.4 1.0 1.0 1.7 2.1 1.7 1.7 2.0 1.5 0.8 0.9 1.7 1.7 2.0 1.8 2.1 1.4 0.9 1.1 1.8 1.9 1.1 0.6 0.4 0.4 0.4 2.3 2.2 2.0 1.8 1.3 0.8 1.0 1.6 2.0 2.0 2.0 1.0 0.8 0.5 0.4 0.4 2.0 2.0 2.7 0.7 0.6 0.6 0.4 0.5 0.4 0.4 0.4 0.9 1.7 2.1 1.8 1.8 2.1 1.7 1.1 1.3 2.0 1.8 4.4 0.3 0.3 0.4 0.4 1.2 1.3 1.4 1.7 2.2 2.3 2.2 2.0 1.4 1.1 1.2 1.8 2.3 0.3 0.3 0.4 5.3 1.7 2.0 1.2 0.7 0.8 1.6 2.0 1.9 2.1 2.7 3.7 4.7 2.5 4.2 3.1 2.5 3.5 2.9 3.0 3.2 3.1 4.4 0.6 0.4 0.4 1.8 1.9 1.4 0.9 0.5 0.9 1.6 2.0 2.0 1.2 0.9 1.0 2.5 3.6 3.8 2.9 2.3 1.7 1.0 2.7 2.1 1.9 1.9 4.3 3.0 3.3 2.9 2.2 2.2 1.4 1.0 2.2 2.2 2.1 2.2 1.9 2.2 1.7 1.4 1.7 2.1 1.9 1.9 1.5 1.9 1.4 1.2 1.9 1.9 2.2 1.4 1.7 3.9 2.1 2.2 0.8 2.3 2.2 2.3 0.3 2.6 2.8 2.4 0.1 0.2 0.2 2.9 2.7 2.2 0.1 3.4 7.5 8.4 8.2 8.3 5.2 3.0 3.0 2.5 1.6 3.3 7.4 7.7 7.8 8.2 5.4 2.9 2.8 2.9 2.9 10.5 12.8 2.6 2.6 2.9 3.8 3.3 2.9 2.8 3.0 8.3 8.8 3.5 1.1 1.3 1.8 1.9 2.0 2.1 1.6 4.1 4.1 2.6 1.9 1.3 1.0 2.5 2.1 1.7 2.0 1.8 2.4 2.1 1.6 1.3 2.7 2.4 1.8 2.2 2.8 2.5 2.2 1.9 1.4 2.5 2.5 1.8 2.7 2.4 2.2 2.2 1.5 2.4 2.7 2.4 3.4 2.2 2.5 2.0 1.3 2.7 2.5 1.9 2.4 2.3 1.8 1.6 1.7 2.1 1.9 1.4 2.1 2.5 2.3 2.0 1.7 1.4 1.1 2.2 2.4 2.4 1.7 1.2 0.9 0.9 2.5 2.4 2.0 1.2 0.9 0.8 0.8 0.9 2.2 2.4 1.9 1.1 0.8 0.7 0.7 0.8 1.2 2.1 1.6 1.1 0.8 0.8 0.8 0.8 0.7 1.2 1.2 1.0 1.0 1.0 0.9 0.9 0.8 0.6 0.7 0.7 0.9 1.4 1.7 1.5 1.3 1.0 0.9 1.3 1.0 0.7 0.8 1.8 2.4 2.3 2.0 1.3 1.0 2.1 1.6 0.9 0.6 1.1 2.0 2.1 2.3 1.8 2.0 1.5 2.1 1.9 1.1 0.6 0.7 2.9 2.5 2.1 1.3 1.8 1.7 3.4 1.9 1.9 1.1 0.6 0.4 2.7 2.3 1.5 1.8 6.3 2.2 2.3 1.7 0.9 0.5 2.3 2.4 1.8 1.2 1.3 3.5 2.1 2.0 1.6 2.0 2.4 2.5 1.8 1.1 0.6 0.4 2.7 2.3 1.6 1.9 4.7 1.9 2.7 1.7 5.1 2.0 2.5 1.9 1.2 0.7 0.5 2.1 2.4 2.0 5.5 10.1 1.4 2.4 2.3 1.7 2.1 3.1 2.0 2.1 1.3 0.7 0.5 0.3 2.0 2.2 1.3 7.0 9.0 1.0 1.9 2.2 2.2 3.9 1.9 1.3 1.2 1.9 1.9 1.9 1.6 0.9 0.5 0.3 2.2 2.1 1.2 7.4 11.1 0.7 1.3 2.0 1.9 1.9 1.7 0.8 0.8 1.0 0.8 0.6 0.5 1.6 3.0 2.2 2.0 1.7 1.1 1.5 1.9 1.8 1.5 0.9 0.6 0.3 1.9 1.6 1.0 0.6 7.3 6.5 1.0 0.6 0.6 0.6 0.8 1.3 1.8 2.2 3.1 2.0 2.4 2.3 2.4 2.0 1.9 2.0 1.3 0.9 0.9 1.0 0.9 0.8 0.5 0.4 0.9 0.9 0.6 0.5 2.8 1.8 0.7 0.5 0.5 0.8 1.6 1.9 2.4 2.2 1.9 2.3 2.0 1.7 1.7 1.8 1.6 1.3 0.8 0.6 0.4 0.5 0.4 0.4 0.3 0.5 0.4 0.4 0.3 1.3 1.0 1.4 1.1 0.8 0.6 0.5 0.8 1.6 2.4 2.1 1.9 1.9 1.8 1.6 1.2 1.0 0.9 0.9 0.8 0.7 0.5 0.3 0.2 0.2 0.2 0.3 0.3 0.3 0.3 1.1 0.9 0.7 2.0 2.0 1.2 0.7 0.5 2.2 2.5 1.9 1.3 1.2 1.0 0.8 0.7 0.5 0.5 0.4 0.4 0.3 0.2 0.2 0.1 0.2 0.2 2.0 1.6 1.6 1.7 1.4 1.1 1.9 1.9 2.2 1.9 2.5 2.0 2.4 1.6 1.0 0.7 0.6 0.5 0.4 0.3 0.3 0.2 1.9 1.5 1.7 2.1 2.0 2.0 1.7 1.3 2.0 2.2 2.1 2.1 2.5 2.4 1.9 1.2 0.8 0.5 0.4 0.3 1.6 2.5 1.7 2.1 1.4 0.9 1.4 1.2 1.4 1.2 1.8 2.0 1.7 1.3 0.9 0.6 0.4 0.3 1.7 1.3 1.0 1.4 1.9 2.0 2.4 2.1 1.8 1.1 1.3 1.3 1.1 0.9 0.7 0.5 1.5 1.9 1.8 1.7 2.0 1.3 2.1 1.8 2.1 1.6 1.0 0.8 0.7 0.6 2.2 1.9 1.4 0.6 0.3 2.0 2.1 2.1 0.8 0.7 0.4 0.2 0.1 0.4 1.4 1.2 1.5 1.6 3.7 1.7 2.1 1.4 0.9 0.9 1.7 2.1 1.3 0.7 2.0 1.7 1.0 1.6 1.1 0.4 0.7 0.9 0.8 0.6 0.3 0.4 0.5 0.5 0.2 0.3 0.3 0.3 0.5 0.4 0.3 1.1 0.7 1.9 1.9 1.2 2.0 2.2 3.1 2.0 2.3 2.5 1.7 2.2 0.8 1.2 1.4 0.8 1.0 0.9 11.2 10.3 9.8 11.9 10.9 10.3 12.1 10.7 10.4 12.0 10.4 10.2 12.2 4.4 5.5 5.5 5.5 6.1 5.9 5.8 6.2 5.9 5.8 6.2 6.3 8.2 9.0 9.2 9.4 7.2 7.9 5.0 5.7 7.3 7.5 6.1 6.9 5.8 6.9 7.5 8.1 5.3 5.9 8.0 5.4 7.0 5.1 8.4 12.6 6.6 8.5 6.4 9.0 12.0 7.7 9.1 8.1 10.5 11.4 3.7 5.7 7.3 11.7 PX1 PX1 PX2 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1 BX1BX1 BX1 BX1 BX1 BX1BX1 BX1 BX1 BX1BX1 BX1 BX1 XP1 1 PX1 PX1 PX1 PX1 PX2 DX2 BX2 BX2 BX2 BX2 BX2 DX2 DX2 DX2 BX2 BX2 BX2 BX2 DX2 DX2 BX2 DX2 BX2 BX2 DX2 BX2 BX2 BX2 DX2 DX2DX2 DX1 DX1 DX1 DX1 DX2 DX2 DX2 NX1 NX1 NX1 NX1 NX1 DX2 DX2 DX2 DX2 DX2DX2 NX1 NX1 DX2 DX1 DX1 DX1 DX2 DX2DX2 DX2 DX2 NX1 NX1 BX1BX1 FX1 FX1 HGA NO: DATE: NO DESCRIPTION DATE CITY OF RICHFIELD WOOD LAKE NATURE CENTERNOT FOR CONSTRUCTION© COPYRIGHT HAMMEL, GREEN AND ABRAHAMSON, INC. ISSUANCE HISTORY - THIS SHEET LAND USE SUBMITTAL DECEMBER 16, 2024 0969-005-00 KEYPLAN AREA A AREA B AREA D AREA C 6710 LAKE SHORE DR S RICHFIELD, MN 55423 1/9/2025 7:41:57 PM C:\Users\eeameliar\Documents\Revit Local Files\E24_Wood Lake Nature Center_0969-005-00_arosenbush.rvtE032 LIGHTING PHOTOMETRICS Author1" = 30'-0"1 LIGHTING SITE PLAN - PHOTOMETRIC AGENDA SECTION:OTHER BUSINESS AGENDA ITEM #6. STAFF REPORT NO. 27 CITY COUNCIL MEETING 2/11/2025 REPORT PREPARED BY:Karl Huemiller, Recreation Services Director DEPARTMENT DIRECTOR REVIEW:Karl Huemiller, Recreation Services Director OTHER DEPARTMENT REVIEW: CITY MANAGER REVIEW: Katie Rodriguez, City Manager 2/6/2025 ITEM FOR COUNCIL CONSIDERATION: M. A. Mortenson Construction proposed Guaranteed Maximum Price for construction of Wood Lake Nature Center. EXECUTIVE SUMMARY: M. A. Mortenson Construction has developed a Guaranteed Maximum Price (GMP) estimate of $21,378,965. This estimate includes the building, general site improvements and the amphitheater adjacent to the building. The GMP is based on bids Mortenson received for each scope of work needed for construction. The bids were made from the drawings and specifications created by HGA during the Design Development (DD) Phase of the Wood Lake Nature Center Building Project, which in turn were created based on feedback from residents, City Council, and staff. Bidding for each scope of work followed the competitive bidding guidelines outlined in state statute and received multiple bids during this process. The GMP document contains six alternates and their corresponding costs. These alternates can be added, expanding the scope of the project. Staff recommend approval of Exhibit "A" amending the contract with M. A. Mortenson Company for the Wood Lake Nature Center Building Project to set the Guaranteed Maximum Price for the construction of the Wood Lake Nature Center Building and surrounding site at $21,378,965. Based on the identified construction risks (outlined in the Historical Context section), staff recommend moving forward with the Ornilux Glazing alternate and completing the design work for the snow melt system and/or the underground ductwork in the multipurpose room. Completing design work and waiting to accept either of these alternate options will provide time to better understand the risk associated with site conditions and the proposed tariffs both of which could significantly impact costs. The decision to include the snow melt system and/or the underground ductwork will need to be made before the risks related to tariffs and site conditions can be fully understood or mitigated. Staff recommend maintaining a significant contingency (3% - 4% of project costs based off the GMP) in place until the building’s footings and structural supports are completed. RECOMMENDED ACTION: By Motion: approve Exhibit "A" amending the contract with M. A. Mortenson Company for the Wood Lake Nature Center Building Project to set the Guaranteed Maximum Price for the construction of the Wood Lake Nature Center Building and surrounding site at $21,378,965, and authorize the Mayor and City Manager to execute the amendment and make adjustments up to $175,000 or as appropriate based on the listed Alternates for the project. BASIS OF RECOMMENDATION: A.HISTORICAL CONTEXT Project Pre-Design A project team was formed in February of 2021 that included City of Richfield staff (Amy Markle, Dave Conrads, Paul Smithson, and Rachel Lindholm), and a group from the local architectural firm, HGA. The project team took a field trip to the new Westwood Hills Nature Center and learned about their process as well as worked for months on the pre-design of a new building. The pre-design process identified community needs for the new building, a general preliminary design, and a cost model. Following the pre-design process, the city was able to use the materials developed to raise funds for the project. In 2023 the City secured $15 million in funding, $12 million in state bonding money, and $3 million in federal funding. In the 2023 legislative session, the City also received authorization for a sales tax referendum that could provide the final $11 million needed for the project. Architect Selection In October of 2023, put out an invitation-only RFP for architectural and engineering services for the design and construction administration of the new nature center building at Wood Lake. Six experienced firms were invited to submit proposals. Of the six firms invited, five submitted proposals, and three were invited to interviews based on the content of their proposals. Out of this process, HGA was selected as the best firm for the Wood Lake Nature Center Building Project. Design Process Once selecting HGA as the architectural and engineering firm for the project City staff worked with HGA through the design process. Starting with the initial programming to develop the building requirements, staff met with community groups, Richfield Public Schools, conducted a visitor survey and held multiple open houses to solicit community input. The requirements developed informed the initial Schematic Design for the building concept. In the Design Development phase the Schematic Design was refined and drawings were created for initial bidding. The next project phase is to develop the final construction documents. Construction Manager at Risk In the spring of 2024 Staff implemented a thorough RFQ and RFP process as outlined in state statute for the selection of a Construction Manager at Risk (CMaR). Five firms submitted qualifications for the RFQ, four were invited to submit for the RFP, and two were interviewed before final scoring took place. Mortenson Construction was the highest-scoring firm showing a site-appropriate approach to the project, a strong team, and the ability to bring significant resources to support the project. In August of 2024 City Council approved the contract for CMaR services with Mortenson Construction. This contract outlined fees for preconstruction and construction services. With the CMaR procurement process, a Guaranteed Maximum Price estimate is agreed upon through an amendment to the contract once a significant portion of the design has been completed. Construction Risks As the project moves into the construction phase, there are risks that staff believe are important to consider. Geothermal system The geothermal system has not been fully designed. The conductivity tests found that the wells were less thermally conductive than anticipated. The impacts of this are currently being explored. If the system needs a significant redesign, this will be considered a design change made during construction. Tariffs - Tariffs have been proposed for products from Canada and Mexico. There is also the potential for tariffs on products from Europe. These tariffs could significantly impact the cost of the project. Many construction products are sourced from Canada and Europe. Some of these products could be sourced from other suppliers not affected by tariffs but this is not the case for all of the products. Unexpected conditions – The majority of project risk comes in the form of unknown site conditions. The Wood Lake Nature Center Building site is a former lakebed which was covered with fill when the current building was constructed. While significant testing has taken place, significant risk related to soil stability and the type of fill that was used remains. Unexpected conditions will remain a risk until the footings are completed and the structural pieces are erected. B.EQUITABLE OR STRATEGIC CONSIDERATIONS OR IMPACTS Equity: The public engagement process during the design phase of the project has a focus on connecting with disadvantaged communities that are currently underrepresented in the users of Wood Lake Nature Center. Design also includes the goals of including feedback from a variety of community stakeholders, including the disability community, the Latine community, low-income residents, residents who live close to Wood Lake, visitors to Richfield, students who visit, and many more groups. Overall, the new building and exhibits will provide increased accessibility to more groups and current ADA guidelines will be met which currently are not. M. A. Mortenson Company has an internal goal of working with 20% women and minority owned businesses on their projects. On past projects they have at rack record of exceeding this goal. Strategic Plan: This project best aligns with the strategic plan priority of Sustainable Infrastructure addressing all sub-initiatives of asset management, comprehensive funding, and sustainability efforts. C.POLICIES (resolutions, ordinances, regulations, statutes, exc): The Construction Manager at Risk process must follow guidelines outlined in Minnesota State Statute 471.463 D.CRITICAL TIMING ISSUES: A delay in reaching a Guaranteed Maximum Price will create project delays that will result in increased costs for the project. E.FINANCIAL IMPACT: Funding The current project budget is $26,425,000 this includes both construction costs and soft costs. This budget is comprised of the $12,000,000 from the state,$3,000,000 from the federal government, $11,000,000 from the sales tax referendum, $200,000 in donations identified for the project, and $225,000 in CIB funds identified for the project. The funding number does not include any rebates we might receive for energy efficiency upgrades. Budget Staff are currently budgeting a 4% contingency (based of GMP) for any unexpected site conditions or design changes we want to make during construction. This contingency can be spent on alternates once certain milestones are reached that reduce the City's risk exposure. There may also be tax credits available through Excel and the State. $21,378,965 - Building Construction Costs $1,685,956 - Architect & Engineering Fees $181,000 - Additional Professional Services $600,000 - Non-Construction Costs $720,000 - Furnishings, Fixtures and Equipment $200,000 - Playground $700,000 - Exhibits $950,000 - Owner Contingency $26,416,421 - Total Project Cost F.LEGAL CONSIDERATION: Staff have been working with the City Attorney to review the contract amendment and ensure compliance with the construction manager at risk statutory requirements. ALTERNATIVE RECOMMENDATION(S): Accept the Guaranteed Maximum Price proposed by M. A. Mortenson Construction along with any desired increases or alternate items. This would result in a reduced owner contingency creating a greater risk that the project would go over the current budget and need additional funding. If the project goes over budget, general obligation property tax bonds could be used to make up the difference. Taking into account other needs expected in the coming years staff does not recommend this alternative option. PRINCIPAL PARTIES EXPECTED AT MEETING: M. A. Mortenson will be at the meeting to answer questions related to the GMP documents. ATTACHMENTS: Description Type Exhibit A - GMP Amendment for the Mortenson CMaR Contract/Agreement Contract (D1) Exhibit F - Drawings, Specifications Exhibit Exhibit G - List of Alternates Exhibit Exhibit H - Project Phasing and Schedule Exhibit Exhibit I - WLNC Estimate Exhibit Exhibit J - Wood Lake Nature Center Narrative Exhibit Exhibit K - List of Allowances Exhibit Document A133® – 2019 Exhibit A Guaranteed Maximum Price Amendment Init. / AIA Document A133 – 2019 Exhibit A. Copyright © 1991, 2003, 2009, and 2019. All rights reserved. “The American Institute of Architects,” “American Institute of Architects,” “AIA,” the AIA Logo, and “AIA Contract Documents” are trademarks of The American Institute of Architects. This document was produced at 17:43:48 ET on 02/04/2025 under Order No.3104238779 which expires on 04/30/2025, is not for resale, is licensed for one-time use only, and may only be used in accordance with the AIA Contract Documents® Terms of Service. To report copyright violations, e-mail docinfo@aiacontracts.com. User Notes: (912879187) 1 ADDITIONS AND DELETIONS: The author of this document has added information needed for its completion. The author may also have revised the text of the original AIA standard form. An Additions and Deletions Report that notes added information as well as revisions to the standard form text is available from the author and should be reviewed. A vertical line in the left margin of this document indicates where the author has added necessary information and where the author has added to or deleted from the original AIA text. This document has important legal consequences. Consultation with an attorney is encouraged with respect to its completion or modification. AIA Document A201™–2017, General Conditions of the Contract for Construction, is adopted in this document by reference. Do not use with other general conditions unless this document is modified. This Amendment dated the 4 day of February in the year 2025, is incorporated into the accompanying AIA Document A133™–2019, Standard Form of Agreement Between Owner and Construction Manager as Constructor where the basis of payment is the Cost of the Work Plus a Fee with a Guaranteed Maximum Price dated the 12 day of November in the year 2024 (the "Agreement") (In words, indicate day, month, and year.) for the following PROJECT: (Name and address or location) Wood Lake Nature Center Building Project 6710 Lake Shore Drive, Richfield, MN 55423 THE OWNER: (Name, legal status, and address) City of Richfield 6700 Portland Avenue Richfield, MN 55423 612-861-9700 THE CONSTRUCTION MANAGER: (Name, legal status, and address) M. A. Mortenson Company 700 Meadow Lane North Minneapolis, MN 55422 TABLE OF ARTICLES A.1 GUARANTEED MAXIMUM PRICE A.2 DATE OF COMMENCEMENT AND SUBSTANTIAL COMPLETION A.3 INFORMATION UPON WHICH AMENDMENT IS BASED A.4 CONSTRUCTION MANAGER’S CONSULTANTS, CONTRACTORS, DESIGN PROFESSIONALS, AND SUPPLIERS ARTICLE A.1 GUARANTEED MAXIMUM PRICE § A.1.1 Guaranteed Maximum Price Pursuant to Section 3.2.6 of the Agreement, the Owner and Construction Manager hereby, effective as of [February 4], 2025, amend the Agreement to establish a Guaranteed Maximum Price. As agreed by the Owner and Construction Manager, the Guaranteed Maximum Price is an amount that the Contract Sum shall not exceed. The Contract Sum consists of the Construction Manager’s Fee plus the Cost of the Work, as that term is defined in Article 6 of the Agreement. § A.1.1.1 The Contract Sum is guaranteed by the Construction Manager not to exceed Twenty One Million Three Hundred Seventy Eight Thousand Nine Hundred Sixty Five Init. / AIA Document A133 – 2019 Exhibit A. Copyright © 1991, 2003, 2009, and 2019. All rights reserved. “The American Institute of Architects,” “American Institute of Architects,” “AIA,” the AIA Logo, and “AIA Contract Documents” are trademarks of The American Institute of Architects. This document was produced at 17:43:48 ET on 02/04/2025 under Order No.3104238779 which expires on 04/30/2025, is not for resale, is licensed for one-time use only, and may only be used in accordance with the AIA Contract Documents® Terms of Service. To report copyright violations, e-mail docinfo@aiacontracts.com. User Notes: (912879187) 2 Dollars ($ 21,378,965.00 ), subject to additions and deductions by Change Order as provided in the Contract Documents. § A.1.1.2 Itemized Statement of the Guaranteed Maximum Price. Provided below is an itemized statement of the Guaranteed Maximum Price organized by trade categories, including allowances; the Construction Manager’s contingency; alternates; the Construction Manager’s Fee; and other items that comprise the Guaranteed Maximum Price as defined in Section 3.2.1 of the Agreement. (Provide itemized statement below or reference an attachment.) Exhibit I – Wood Lake Nature Center Estimate 02.04.25 § A.1.1.3 The Construction Manager’s Fee is set forth in Section 6.1.2 of the Agreement. § A.1.1.4 The method of adjustment of the Construction Manager’s Fee for changes in the Work is set forth in Section 6.1.3 of the Agreement. § A.1.1.5 Alternates § A.1.1.5.1 Alternates, if any, included in the Guaranteed Maximum Price: Item Price § A.1.1.5.2 Subject to the conditions noted below, the following alternates may be accepted by the Owner following execution of this Exhibit A. Upon acceptance, the Owner shall issue a Modification to the Agreement. (Insert below each alternate and the conditions that must be met for the Owner to accept the alternate.) Exhibit G – List of Alternates Item Price Conditions for Acceptance § A.1.1.6 Unit prices, if any: (Identify the item and state the unit price and quantity limitations, if any, to which the unit price will be applicable.) Item Units and Limitations Price per Unit ($0.00) ARTICLE A.2 DATE OF COMMENCEMENT AND SUBSTANTIAL COMPLETION § A.2.1 The date of commencement of the Work shall be: (Check one of the following boxes.) Exhibit H – Project Phasing and Schedule [ X ]The date of execution of this Amendment. [ ]Established as follows: (Insert a date or a means to determine the date of commencement of the Work.) If a date of commencement of the Work is not selected, then the date of commencement shall be the date of execution of this Amendment. § A.2.2 Unless otherwise provided, the Contract Time is the period of time, including authorized adjustments, allotted in the Contract Documents for Substantial Completion of the Work. The Contract Time shall be measured from the date of commencement of the Work. Init. / AIA Document A133 – 2019 Exhibit A. Copyright © 1991, 2003, 2009, and 2019. All rights reserved. “The American Institute of Architects,” “American Institute of Architects,” “AIA,” the AIA Logo, and “AIA Contract Documents” are trademarks of The American Institute of Architects. This document was produced at 17:43:48 ET on 02/04/2025 under Order No.3104238779 which expires on 04/30/2025, is not for resale, is licensed for one-time use only, and may only be used in accordance with the AIA Contract Documents® Terms of Service. To report copyright violations, e-mail docinfo@aiacontracts.com. User Notes: (912879187) 3 § A.2.3 Substantial Completion § A.2.3.1 Subject to adjustments of the Contract Time as provided in the Contract Documents, the Construction Manager shall achieve Substantial Completion of the entire Work: (Check one of the following boxes and complete the necessary information.) [ ]Not later than ( ) calendar days from the date of commencement of the Work. [ X ]By the following date: July 2, 2026 § A.2.3.2 Subject to adjustments of the Contract Time as provided in the Contract Documents, if portions of the Work are to be completed prior to Substantial Completion of the entire Work, the Construction Manager shall achieve Substantial Completion of such portions by the following dates: Portion of Work Substantial Completion Date § A.2.3.3 If the Construction Manager fails to achieve Substantial Completion as provided in this Section A.2.3, liquidated damages, if any, shall be assessed as set forth in Section 6.1.6 of the Agreement. ARTICLE A.3 INFORMATION UPON WHICH AMENDMENT IS BASED § A.3.1 The Guaranteed Maximum Price and Contract Time set forth in this Amendment are based on the Contract Documents and the following: § A.3.1.1 The following Supplementary and other Conditions of the Contract: Document Title Date Pages § A.3.1.2 The following Specifications: (Either list the Specifications here, or refer to an exhibit attached to this Amendment.) Exhibit F – Drawings and Specifications Section Title Date Pages § A.3.1.3 The following Drawings: (Either list the Drawings here, or refer to an exhibit attached to this Amendment.) Exhibit F – Drawings and Specifications Number Title Date § A.3.1.4 The Sustainability Plan, if any: (If the Owner identified a Sustainable Objective in the Owner’s Criteria, identify the document or documents that comprise the Sustainability Plan by title, date and number of pages, and include other identifying information. The Sustainability Plan identifies and describes the Sustainable Objective; the targeted Sustainable Measures; implementation strategies selected to achieve the Sustainable Measures; the Owner’s and Construction Manager’s roles and responsibilities associated with achieving the Sustainable Measures; the specific details about design reviews, testing or metrics to verify achievement of each Sustainable Measure; and the Sustainability Documentation required for the Project, as those terms are defined in Exhibit C to the Agreement.) Title Date Pages Other identifying information: Init. / AIA Document A133 – 2019 Exhibit A. Copyright © 1991, 2003, 2009, and 2019. All rights reserved. “The American Institute of Architects,” “American Institute of Architects,” “AIA,” the AIA Logo, and “AIA Contract Documents” are trademarks of The American Institute of Architects. This document was produced at 17:43:48 ET on 02/04/2025 under Order No.3104238779 which expires on 04/30/2025, is not for resale, is licensed for one-time use only, and may only be used in accordance with the AIA Contract Documents® Terms of Service. To report copyright violations, e-mail docinfo@aiacontracts.com. User Notes: (912879187) 4 § A.3.1.5 Allowances, if any, included in the Guaranteed Maximum Price: (Identify each allowance.) Exhibit K – List of Allowances Item Price § A.3.1.6 Assumptions and clarifications, if any, upon which the Guaranteed Maximum Price is based: (Identify each assumption and clarification.) Exhibit J – Project Narrative § A.3.1.7 The Guaranteed Maximum Price is based upon the following other documents and information: (List any other documents or information here, or refer to an exhibit attached to this Amendment.) Although this Guaranteed Maximum Price Amendment is executed after the announcement of certain tariffs, the Guaranteed Maximum Price contained herein was prepared before such announcement, and as of the date of this Guaranteed Maximum Price Amendment, the specific impact of such tariffs is uncertain. Accordingly, the Guaranteed Maximum Price does not currently include the cost of tariffs, and for purposes of this Guaranteed Maximum Price Amendment, Construction Manager has assumed that the Work will not be subject to any tariffs. In the event that any tariffs affect the timing or cost of the Work, Construction Manager shall be entitled to an equitable adjustment to the Guaranteed Maximum Price or Contract Time, or both, as applicable. The equitable adjustment shall be for the actual, substantiated costs or time impacts arising from any tariffs, without additional overhead and profit. ARTICLE A.4 CONSTRUCTION MANAGER’S CONSULTANTS, CONTRACTORS, DESIGN PROFESSIONALS, AND SUPPLIERS § A.4.1 The Construction Manager shall retain the consultants, contractors, design professionals, and suppliers, identified below: (List name, discipline, address, and other information.) This Amendment to the Agreement entered into as of the day and year first written above. OWNER (Signature)CONSTRUCTION MANAGER (Signature) (Printed name and title)(Printed name and title) Additions and Deletions Report for AIA® Document A133® – 2019 Exhibit A This Additions and Deletions Report, as defined on page 1 of the associated document, reproduces below all text the author has added to the standard form AIA document in order to complete it, as well as any text the author may have added to or deleted from the original AIA text. Added text is shown underlined. Deleted text is indicated with a horizontal line through the original AIA text. Note: This Additions and Deletions Report is provided for information purposes only and is not incorporated into or constitute any part of the associated AIA document. This Additions and Deletions Report and its associated document were generated simultaneously by AIA software at 17:43:48 ET on 02/04/2025. Additions and Deletions Report for AIA Document A133 – 2019 Exhibit A. Copyright © 1991, 2003, 2009, and 2019. All rights reserved. “The American Institute of Architects,” “American Institute of Architects,” “AIA,” the AIA Logo, and “AIA Contract Documents” are trademarks of The American Institute of Architects. This document was produced at 17:43:48 ET on 02/04/2025 under Order No.3104238779 which expires on 04/30/2025, is not for resale, is licensed for one-time use only, and may only be used in accordance with the AIA Contract Documents® Terms of Service. To report copyright violations, e-mail docinfo@aiacontracts.com. User Notes: (912879187) 1 PAGE 1 This Amendment dated the 4 day of February in the year , 2025, is incorporated into the accompanying AIA Document A133™–2019, Standard Form of Agreement Between Owner and Construction Manager as Constructor where the basis of payment is the Cost of the Work Plus a Fee with a Guaranteed Maximum Price dated the 12 day of November in the year 2024 (the "Agreement") … Wood Lake Nature Center Building Project 6710 Lake Shore Drive, Richfield, MN 55423 … (Name, legal status, and address) City of Richfield 6700 Portland Avenue Richfield, MN 55423 612-861-9700 … M. A. Mortenson Company 700 Meadow Lane North Minneapolis, MN 55422 … Pursuant to Section 3.2.6 of the Agreement, the Owner and Construction Manager hereby hereby, effective as of [February 4], 2025, amend the Agreement to establish a Guaranteed Maximum Price. As agreed by the Owner and Construction Manager, the Guaranteed Maximum Price is an amount that the Contract Sum shall not exceed. The Contract Sum consists of the Construction Manager’s Fee plus the Cost of the Work, as that term is defined in Article 6 of the Agreement. § A.1.1.1 The Contract Sum is guaranteed by the Construction Manager not to exceed Twenty One Million Three Hundred Seventy Eight Thousand Nine Hundred Sixty Five Dollars ($ 21,378,965.00 ), subject to additions and deductions by Change Order as provided in the Contract Documents. PAGE 2 Exhibit I – Wood Lake Nature Center Estimate 02.04.25 … Additions and Deletions Report for AIA Document A133 – 2019 Exhibit A. Copyright © 1991, 2003, 2009, and 2019. All rights reserved. “The American Institute of Architects,” “American Institute of Architects,” “AIA,” the AIA Logo, and “AIA Contract Documents” are trademarks of The American Institute of Architects. This document was produced at 17:43:48 ET on 02/04/2025 under Order No.3104238779 which expires on 04/30/2025, is not for resale, is licensed for one-time use only, and may only be used in accordance with the AIA Contract Documents® Terms of Service. To report copyright violations, e-mail docinfo@aiacontracts.com. User Notes: (912879187) 2 Exhibit G – List of Alternates … Exhibit H – Project Phasing and Schedule [ X ]The date of execution of this Amendment. PAGE 3 [ X ]By the following date: July 2, 2026 … Exhibit F – Drawings and Specifications … Exhibit F – Drawings and Specifications PAGE 4 Exhibit K – List of Allowances … Exhibit J – Project Narrative … Although this Guaranteed Maximum Price Amendment is executed after the announcement of certain tariffs, the Guaranteed Maximum Price contained herein was prepared before such announcement, and as of the date of this Guaranteed Maximum Price Amendment, the specific impact of such tariffs is uncertain. Accordingly, the Guaranteed Maximum Price does not currently include the cost of tariffs, and for purposes of this Guaranteed Maximum Price Amendment, Construction Manager has assumed that the Work will not be subject to any tariffs. In the event that any tariffs affect the timing or cost of the Work, Construction Manager shall be entitled to an equitable adjustment to the Guaranteed Maximum Price or Contract Time, or both, as applicable. The equitable adjustment shall be for the actual, substantiated costs or time impacts arising from any tariffs, without additional overhead and profit. AIA Document D401 – 2003. Copyright © 1992 and 2003. All rights reserved. “The American Institute of Architects,” “American Institute of Architects,” “AIA,” the AIA Logo, and “AIA Contract Documents” are trademarks of The American Institute of Architects. This document was produced at 17:43:48 ET on 02/04/2025 under Order No.3104238779 which expires on 04/30/2025, is not for resale, is licensed for one-time use only, and may only be used in accordance with the AIA Contract Documents® Terms of Service. To report copyright violations, e-mail docinfo@aiacontracts.com. User Notes: (912879187) 1 Certification of Document’s Authenticity AIA® Document D401™ – 2003 I, , hereby certify, to the best of my knowledge, information and belief, that I created the attached final document simultaneously with its associated Additions and Deletions Report and this certification at 17:43:48 ET on 02/04/2025 under Order No. 3104238779 from AIA Contract Documents software and that in preparing the attached final document I made no changes to the original text of AIA® Document A133™ – 2019 Exhibit A, Guaranteed Maximum Price Amendment, other than those additions and deletions shown in the associated Additions and Deletions Report. _____________________________________________________________ (Signed) _____________________________________________________________ (Title) _____________________________________________________________ (Dated) EXHIBIT F - Drawings and Specifications Discipline Drawing No.Drawing Title Revision Drawing Date General G031 LIFE SAFETY PLAN LEVEL 011 12/12/2024 General G032 LIFE SAFETY - CODE SUMMARY1 12/12/2024 SURVEY COOO-1 SURVEY - FOR REFERENCE ONLY1 12/12/2024 SURVEY COOO-2 SURVEY - FOR REFERENCE ONLY1 12/12/2024 SURVEY COOO-3 SURVEY - FOR REFERENCE ONLY1 12/12/2024 CIVIL C001 CIVIL NOTES AND LEGEND1 12/12/2024 CIVIL C002 OVERALL SITE PLAN1 12/12/2024 CIVIL C100 STORMWATER POLLUTION PREVENTION PLAN (SWPP)112/12/2024 CIVIL C101 SITE EROSION AND SEDIMENT CONTROL DETAILS1 12/12/2024 CIVIL C102 EROSION AND SEDIMENT CONTROL DETAILS1 12/12/2024 CIVIL C200 SITE DEMOLITION PLAN1 12/12/2024 CIVIL C300 SITE LAYOUT AND SURFACING PLAN1 12/12/2024 CIVIL C400 SITE GRADING PLAN1 12/12/2024 CIVIL C401 ENLARGED GRADING PLAN1 12/12/2024 CIVIL C402 ENLARGED GRADING PLAN1 12/12/2024 CIVIL C420 ENLARGED BIOFILTRATION BASIN PLAN1 12/12/2024 CIVIL C500 SITE UTILITY PLAN1 12/12/2024 CIVIL C505 SEWER STRUCTURE SCHEDULE AND DETAILS1 12/12/2024 CIVIL C900 SITE DETAILS1 12/12/2024 CIVIL C901 SITE DETAILS1 12/12/2024 CIVIL C902 SITE DETAILS1 12/12/2024 LANDSCAPE L100 OVERALL TREE PROTECTION PLAN1 12/12/2024 LANDSCAPE L120 TREE PRESERVATION AND PROTECTION DETAILS1 12/12/2024 LANDSCAPE L200 OVERALL LAYOUT & MATERIALS PLAN1 12/12/2024 LANDSCAPE L201 LAYOUT & MATERIALS PLAN1 12/12/2024 LANDSCAPE L210 AMPHITHEATER PLAN & DETAILS1 12/12/2024 LANDSCAPE L220 LAYOUT & MATERIAL DETAILS1 12/12/2024 LANDSCAPE L221 LAYOUT & MATERIAL DETAILS1 12/12/2024 LANDSCAPE L300 OVERALL SURFACING PLAN1 12/12/2024 LANDSCAPE L301 SURFACING PLAN1 12/12/2024 LANDSCAPE L400 OVERALL PLANTING PLAN1 12/12/2024 LANDSCAPE L401 PLANTING PLAN1 12/12/2024 LANDSCAPE L410 ENLARGED PLANTING PLAN1 12/12/2024 LANDSCAPE L420 PLANTING DETAILS1 12/12/2024 LANDSCAPE L421 PLANTING DETAILS1 12/12/2024 LANDSCAPE L440 PLANT MATERIALS SCHEDULE1 12/12/2024 STRUCTURAL S001 GENERAL STRUCTURAL NOTES AND ABBREVIATIONS1 12/12/2024 STRUCTURAL S002 POST-INSTALLED ANCHORS AND ISOMETRIC VIEW1 12/12/2024 STRUCTURAL S004 FOUNDATION REACTIONS1 12/12/2024 STRUCTURAL S200 FOUNDATION AND FLOOR PLAN1 12/12/2024 STRUCTURAL S201 ROOF PLAN1 12/12/2024 STRUCTURAL S300 BUILDING ELEVATIONS1 12/12/2024 STRUCTURAL S310 BUILDING SECTIONS1 12/12/2024 STRUCTURAL S500 TYPICAL FOUNDATION DETAILS1 12/12/2024 STRUCTURAL S501 FOUNDATION DETAILS1 12/12/2024 STRUCTURAL S700 STEEL DETAILS1 12/12/2024 STRUCTURAL S800 TYPICAL WOOD DETAILS1 12/12/2024 STRUCTURAL S801 TYPICAL WOOD DETAILS1 12/12/2024 STRUCTURAL S802 TYPICAL TIMBER DETAILS1 12/12/2024 STRUCTURAL S811 PROJECT TIMBER DETAILS1 12/12/2024 Drawings ARCHITECTURAL A010 GENERAL NOTES AND SYMBOLS1 12/12/2024 ARCHITECTURAL A011 MATERIAL ID1 12/12/2024 ARCHITECTURAL A200 FLOOR PLAN - OVERALL1 12/12/2024 ARCHITECTURAL A201A FLOOR PLAN - AREA A1 12/12/2024 ARCHITECTURAL A201B FLOOR PLAN - AREA B1 12/12/2024 ARCHITECTURAL A201C FLOOR PLAN - AREA C1 12/12/2024 ARCHITECTURAL A201D FLOOR PLAN - AREA D1 12/12/2024 ARCHITECTURAL A206 ROOF PLAN - OVERALL1 12/12/2024 ARCHITECTURAL A241A FINISH PLAN - AREA A1 12/12/2024 ARCHITECTURAL A241B FINISH PLAN - AREA B1 12/12/2024 ARCHITECTURAL A241C FINISH PLAN - AREA C1 12/12/2024 ARCHITECTURAL A241D FINISH PLAN - AREA D1 12/12/2024 ARCHITECTURAL A261 FURNITURE PLAN - FOR REFERENCE ONLY1 12/12/2024 ARCHITECTURAL A301 REFLECTED CEILING PLAN - OVERALL1 12/12/2024 ARCHITECTURAL A301A REFLECTED CEILING PLAN - AREA A1 12/12/2024 ARCHITECTURAL A301B REFLECTED CEILING PLAN - AREA B1 12/12/2024 ARCHITECTURAL A301C REFLECTED CEILING PLAN - AREA C1 12/12/2024 ARCHITECTURAL A301D REFLECTED CEILING PLAN - AREA D1 12/12/2024 ARCHITECTURAL A400 EXTERIOR RENDERINGS - FOR REFERENCE ONLY1 12/12/2024 ARCHITECTURAL A401 EXTERIOR ELEVATIONS1 12/12/2024 ARCHITECTURAL A402 EXTERIOR ELEVATIONS1 12/12/2024 ARCHITECTURAL A410 BUILDING SECTIONS1 12/12/2024 ARCHITECTURAL A420 WALL SECTIONS1 12/12/2024 ARCHITECTURAL A421 WALL SECTIONS1 12/12/2024 ARCHITECTURAL A422 WALL SECTIONS1 12/12/2024 ARCHITECTURAL A460 EXTERIOR WALL TYPES1 12/12/2024 ARCHITECTURAL A461 SINGLE PLY ROOF DETAILS1 12/12/2024 ARCHITECTURAL A470 EXTERIOR DETAILS1 12/12/2024 ARCHITECTURAL A471 EXTERIOR DETAILS1 12/12/2024 ARCHITECTURAL A490 WINDOW TYPES1 12/12/2024 ARCHITECTURAL A500 UTILITY YARD PLAN & DETAILS1 12/12/2024 ARCHITECTURAL A501 EXTERIOR DECK PLAN AND DETAILS1 12/12/2024 ARCHITECTURAL A502 SHIPS LADDER/ BOLLARD1 12/12/2024 ARCHITECTURAL A600 TYPICAL MOUNTING HEIGHTS & ACCESSIBILITY1 12/12/2024 ARCHITECTURAL A601 INTERIOR ELEVATIONS1 12/12/2024 ARCHITECTURAL A602 INTERIOR ELEVATIONS1 12/12/2024 ARCHITECTURAL A603 ENLARGED TOILET PLANS AND ELEVATIONS1 12/12/2024 ARCHITECTURAL A604 ENLARGED TOILET PLANS AND ELEVATIONS1 12/12/2024 ARCHITECTURAL A605 ENLARGED TOILET PLANS AND ELEVATIONS1 12/12/2024 ARCHITECTURAL A606 ENLARGED RECEPTION DESK PLAN AND DETAILS1 12/12/2024 ARCHITECTURAL A700 TYPICAL WOOD INTERIOR PARTITION TYPES AND DETAILS1 12/12/2024 ARCHITECTURAL A701 TOILET/SHOWER DETAILS1 12/12/2024 ARCHITECTURAL A730 CEILING DETAILS1 12/12/2024 ARCHITECTURAL A740 CASEWORK MENU AND DETAILS1 12/12/2024 ARCHITECTURAL A741 CASEWORK DETAILS1 12/12/2024 ARCHITECTURAL A800 DOOR TYPES AND DETAILS1 12/12/2024 ARCHITECTURAL A801 DOOR SCHEDULE1 12/12/2024 FIRE PROTECTION F000 FIRE PROTECTION GENERAL NOTES AND SYMBOLS1 12/12/2024 FIRE PROTECTION F201 FIRE PROTECTION PLAN - LEVEL 011 12/12/2024 FIRE PROTECTION F401 FIRE PROTECTION RISER1 12/12/2024 FIRE PROTECTION F700 FIRE PROTECTION DETAILS1 12/12/2024 PLUMBING P001 PLUMBING GENERAL NOTES AND SYMBOLS1 12/12/2024 PLUMBING P20U PLUMBING PLAN - UNDERGROUND - OVERALL1 12/12/2024 PLUMBING P201 PLUMBING PLAN - LEVEL 01 - OVERALL1 12/12/2024 PLUMBING P202 PLUMBING PLAN - ROOF1 12/12/2024 PLUMBING P700 PLUMBING DETAILS1 12/12/2024 PLUMBING P701 PLUMBING DETAILS1 12/12/2024 PLUMBING P800 PLUMBING SCHEDULES1 12/12/2024 MECHANICAL M001 MECHANICAL ABBREVIATIONS1 12/12/2024 MECHANICAL M040 MECHANICAL SITE PLAN1 12/12/2024 MECHANICAL M050 GEOTHERMAL SITE PLAN1 12/12/2024 MECHANICAL M20U HVAC FLOOR PLAN - UNDERGROUND - OVERALL1 12/12/2024 MECHANICAL M201 HVAC FLOOR PLAN - LEVEL 01 - OVERALL1 12/12/2024 MECHANICAL M201A HVAC FLOOR PLAN - LEVEL 01 - AREA A1 12/12/2024 MECHANICAL M201B HVAC FLOOR PLAN - LEVEL 01 - AREA B1 12/12/2024 MECHANICAL M201C HVAC FLOOR PLAN - LEVEL 01 - AREA C1 12/12/2024 MECHANICAL M201D HVAC FLOOR PLAN - LEVEL 01 - AREA D1 12/12/2024 MECHANICAL M301 PIPING FLOOR PLAN - LEVEL 01 - OVERALL1 12/12/2024 MECHANICAL M301A PIPING FLOOR PLAN - LEVEL 01 - AREA A1 12/12/2024 MECHANICAL M301B PIPING FLOOR PLAN - LEVEL 01 - AREA B1 12/12/2024 MECHANICAL M301C PIPING FLOOR PLAN - LEVEL 01 - AREA C1 12/12/2024 MECHANICAL M301D PIPING FLOOR PLAN - LEVEL 01 - AREA D1 12/12/2024 MECHANICAL M600 CONDENSER WATER DIAGRAM1 12/12/2024 MECHANICAL M700 MECHANICAL DETAILS1 12/12/2024 MECHANICAL M701 MECHANICAL DETAILS1 12/12/2024 MECHANICAL M702 MECHANICAL DETAILS1 12/12/2024 MECHANICAL M703 MECHANICAL DETAILS1 12/12/2024 MECHANICAL M704 MECHANICAL DETAILS1 12/12/2024 MECHANICAL M800 MECHANICAL SCHEDULES1 12/12/2024 MECHANICAL M801 MECHANICAL SCHEDULES1 12/12/2024 ELECTRICAL E000 ELECTRICAL GENERAL NOTES AND SYMBOLS1 12/12/2024 ELECTRICAL E031 LIGHTING AND POWER SITE PLAN1 12/12/2024 ELECTRICAL E050 ELECTRICAL ONE-LINE DIAGRAM1 12/12/2024 ELECTRICAL E051 GROUNDING DIAGRAM1 12/12/2024 ELECTRICAL E200 OVERALL LIGHTING PLAN - LEVEL 011 12/12/2024 ELECTRICAL E201A LIGHTING PLAN - LEVEL 01 - AREA A1 12/12/2024 ELECTRICAL E201B LIGHTING PLAN - LEVEL 01 - AREA B1 12/12/2024 ELECTRICAL E201C LIGHTING PLAN - LEVEL 01 - AREA C1 12/12/2024 ELECTRICAL E201D LIGHTING PLAN - LEVEL 01 - AREA D1 12/12/2024 ELECTRICAL E300 OVERALL POWER PLAN - LEVEL 011 12/12/2024 ELECTRICAL E301A POWER PLAN - LEVEL 01 - AREA A1 12/12/2024 ELECTRICAL E301B POWER PLAN - LEVEL 01 - AREA B1 12/12/2024 ELECTRICAL E301C POWER PLAN - LEVEL 01 - AREA C1 12/12/2024 ELECTRICAL E301D POWER PLAN - LEVEL 01 - AREA D1 12/12/2024 ELECTRICAL E302 POWER PLAN - ROOF1 12/12/2024 ELECTRICAL E400 OVERALL FIRE ALARM PLAN - LEVEL 011 12/12/2024 ELECTRICAL E401A FIRE ALARM PLAN - LEVEL 01 - AREA A1 12/12/2024 ELECTRICAL E401B FIRE ALARM PLAN - LEVEL 01 - AREA B1 12/12/2024 ELECTRICAL E401C FIRE ALARM PLAN - LEVEL 01 - AREA C1 12/12/2024 ELECTRICAL E401D FIRE ALARM PLAN - LEVEL 01 - AREA D1 12/12/2024 ELECTRICAL E500 LUMINAIRE SCHEDULE1 12/12/2024 ELECTRICAL E505 LIGHTING CONTROL INTENT1 12/12/2024 ELECTRICAL E510 PANELBOARD SCHEDULES1 12/12/2024 ELECTRICAL E511 PANELBOARD SCHEDULES1 12/12/2024 ELECTRICAL E601 ELECTRICAL DETAILS1 12/12/2024 ELECTRICAL E602 FIRE ALARM DETAILS1 12/12/2024 ELECTRICAL E620 LIGHTING DETAILS1 12/12/2024 ELECTRICAL EM800 ELECTRICAL MECHANICAL COORDINATION SCHEDULES1 12/12/2024 TECHNOLOGY T000 TECHNOLOGY COMBINED LEGEND1 12/12/2024 TECHNOLOGY T030 TECHNOLOGY SITE PLAN1 12/12/2024 TECHNOLOGY T201 TECHNOLOGY PLAN - OVERALL1 12/12/2024 TECHNOLOGY T201A TECHNOLOGY PLAN - AREA A1 12/12/2024 TECHNOLOGY T201B TECHNOLOGY PLAN - AREA B1 12/12/2024 TECHNOLOGY T201C TECHNOLOGY PLAN - AREA C1 12/12/2024 TECHNOLOGY T201D TECHNOLOGY PLAN - AREA D1 12/12/2024 TECHNOLOGY T500 TECHNOLOGY ENLARGED PLANS - TELECOM 1481 12/12/2024 TECHNOLOGY T501 TECHNOLOGY ENLARGED PLANS - AV 1251 12/12/2024 TECHNOLOGY T600 TELECOM CONDUIT AND BACKBONE CABLING DIAGRAMS1 12/12/2024 TECHNOLOGY T610 SECURITY DIAGRAMS1 12/12/2024 TECHNOLOGY T620 AV FUNCTIONAL DIAGRAMS - PAGING & SOUND MASKING1 12/12/2024 TECHNOLOGY T621 AV FUNCTIONAL DIAGRAM - MULTIPURPOSE ROOMS1 12/12/2024 TECHNOLOGY T700 TECHNOLOGY SITE DETAILS1 12/12/2024 TECHNOLOGY T701 TECHNOLOGY PATHWAY DETAILS1 12/12/2024 TECHNOLOGY T702 TECHNOLOGY PATHWAY DETAILS1 12/12/2024 TECHNOLOGY T710 TECHNOLOGY DEVICE MOUNTING DETAILS1 12/12/2024 TECHNOLOGY T731 ACCESS CONTROL DETAILS - TYPE A1 12/12/2024 TECHNOLOGY T732 ACCESS CONTROL DETAILS - TYPE B1 12/12/2024 TECHNOLOGY T733 ACCESS CONTROL DETAILS - TYPE C1 12/12/2024 TECHNOLOGY T734 ACCESS CONTROL DETAILS - GLASS DOOR1 12/12/2024 Discipline Drawing No.Drawing Title Revision Drawing Date GENERAL REQ.11100 Summary of Work 112/12/2024 GENERAL REQ.12300 Alternates 112/12/2024 GENERAL REQ.12600 Contract Modification Procedures 112/12/2024 GENERAL REQ.12613 Requests for Interpretation 112/12/2024 GENERAL REQ.12900 Payment Procedures 112/12/2024 GENERAL REQ.13100 Project Management & Coordination 112/12/2024 GENERAL REQ.13200 Construction Progress Schedules 112/12/2024 GENERAL REQ.13300 Submittal Procedures 112/12/2024 GENERAL REQ.13310 Submittal Transmittal Form 112/12/2024 GENERAL REQ.14300 Mockups 112/12/2024 GENERAL REQ.14500 Quality Requirements 112/12/2024 GENERAL REQ.14533.1 Structural Testing and Special Inspections 112/12/2024 GENERAL REQ.15000 Temporary Facilities & Controls 112/12/2024 GENERAL REQ.16000 Product Requirements & Substitution Procedures 112/12/2024 GENERAL REQ.16211 Substitution Request Form 112/12/2024 GENERAL REQ.17300 Execution 112/12/2024 GENERAL REQ.17324 Anchorage and Sleeving 112/12/2024 GENERAL REQ.17420 Construction Waste Management 112/12/2024 GENERAL REQ.17700 Closeout Procedures 112/12/2024 GENERAL REQ.17800 Closeout Submittals 112/12/2024 GENERAL REQ.17900 Demonstration & Training 112/12/2024 GENERAL REQ.18113 Sustainable Design Requirements 112/12/2024 GENERAL REQ.18113.01 Sustainability Submittal Coversheet 112/12/2024 GENERAL REQ.18119 Indoor Air Quality Requirements 112/12/2024 GENERAL REQ.19100 Commissioning 112/12/2024 CONCRETE 31100 Concrete Forming 112/12/2024 CONCRETE 31500 Concrete Accessories 112/12/2024 CONCRETE 32000 Concrete Reinforcing 112/12/2024 CONCRETE 33000 Cast-In-Place Concrete 112/12/2024 CONCRETE 33544 Polished Concrete Finish 112/12/2024 METALS 51200 Structural Steel Framing 112/12/2024 METALS 55000 Metal Fabrications 112/12/2024 METALS 57200 Decorative Railings 112/12/2024 WOOD, PLASTICS 61000 Rough Carpentry 112/12/2024 WOOD, PLASTICS 61533 Exterior Composite Lumber Decking 112/12/2024 Specification WOOD, PLASTICS 61719 Cross-Laminated Timber 112/12/2024 WOOD, PLASTICS 61800 Glued-Laminated Construction 112/12/2024 WOOD, PLASTICS 62016 Exterior Wood Siding 112/12/2024 WOOD, PLASTICS 64000 Architectural Woodwork 112/12/2024 THERMAL PROTECTION 71326 Self-Adhering Sheet Waterproofing 112/12/2024 THERMAL PROTECTION 72100 Thermal Insulation 112/12/2024 THERMAL PROTECTION 72600 Vapor Retarders 112/12/2024 THERMAL PROTECTION 72700 Air Barriers 112/12/2024 THERMAL PROTECTION 75300 Elastomeric Membrane (EPDM) Roofing 112/12/2024 THERMAL PROTECTION 75500 Fluid-Applied Protected Membrane Roofing 112/12/2024 THERMAL PROTECTION 76200 Sheet Metal & Flashing 112/12/2024 THERMAL PROTECTION 77233 Roof Hatches 112/12/2024 THERMAL PROTECTION 79200 Joint Sealants 112/12/2024 OPENINGS 81113 Hollow Metal Doors & Frames 112/12/2024 OPENINGS 81400 Wood Doors 112/12/2024 OPENINGS 83100 Access Doors & Panels 112/12/2024 OPENINGS 84400 Aluminum-Framed Glazing Systems 112/12/2024 OPENINGS 87100 Door Hardware 112/12/2024 OPENINGS 88000 Glazing 112/12/2024 OPENINGS 88700 Glass Surface Film 112/12/2024 OPENINGS 89100 Louvers 112/12/2024 FINISHES 92900 Gypsum Board 112/12/2024 FINISHES 93000 Tiling 112/12/2024 FINISHES 95100 Acoustical Ceilings 112/12/2024 FINISHES 95445 Felt Panel Ceilings 112/12/2024 FINISHES 96001 Flooring Transition Strips 112/12/2024 FINISHES 96500 Resilient Flooring 112/12/2024 FINISHES 96800 Carpeting 112/12/2024 FINISHES 97200 Wall Coverings 112/12/2024 FINISHES 97700 Fiberglass Reinforced Panels 112/12/2024 FINISHES 98400 Acoustic Panels 112/12/2024 FINISHES 98410 Fabric-Wrapped Acoustic Panels 112/12/2024 FINISHES 99000 Painting 112/12/2024 FINISHES 99600 High-Performance Coatings 112/12/2024 SPECIALTIES 101100 Visual Display Boards 112/12/2024 SPECIALTIES 101400 ADA Signage 112/12/2024 SPECIALTIES 102239 Operable Partitions 112/12/2024 SPECIALTIES 102600 Wall Protection 112/12/2024 SPECIALTIES 102813 Toilet & Building Accessories 112/12/2024 SPECIALTIES 103100 Manufactured Fireplaces 112/12/2024 SPECIALTIES 104400 Fire Protection Specialties 112/12/2024 EQUIPMENT 113400 Appliances & Equipment 112/12/2024 EQUIPMENT 115200 Audio-Visual Equipment 112/12/2024 EQUIPMENT 115900 Exhibit Equipment 112/12/2024 FURNISHINGS 122413 Roller Window Shades 112/12/2024 FURNISHINGS 124844 Entrance Floor Mats 112/12/2024 FIRE PROTECTION 210500 Common Work Results for Fire Suppression 112/12/2024 FIRE PROTECTION 210517 Sleeves and Sleeve Seals for Fire-Suppression Piping 112/12/2024 FIRE PROTECTION 210518 Escutcheons for Fire-Suppression Piping 112/12/2024 FIRE PROTECTION 210529 Hangers and Supports for Fire Suppression Piping and Equipment 112/12/2024 FIRE PROTECTION 210553 Identification for Fire Suppression Piping and Equipment 112/12/2024 FIRE PROTECTION 211313 Wet-Pipe Sprinkler Systems 112/12/2024 PLUMBING 220500 Common Work Results for Plumbing 112/12/2024 PLUMBING 220513 Common Motor Requirements for Plumbing Equipment 112/12/2024 PLUMBING 220517 Sleeves and Sleeve Seals for Plumbing Piping 112/12/2024 PLUMBING 220518 Escutcheons for Plumbing Piping 112/12/2024 PLUMBING 220519 Meters and Gages for Plumbing Piping 112/12/2024 PLUMBING 220523.1 Ball Valves for Plumbing Piping 112/12/2024 PLUMBING 220523.2 Check Valves for Plumbing Piping 112/12/2024 PLUMBING 220529 Hangers and Supports for Plumbing Piping and Equipment 112/12/2024 PLUMBING 220533 Heat Tracing for Plumbing Piping 112/12/2024 PLUMBING 220553 Identification for Plumbing Piping and Equipment 112/12/2024 PLUMBING 220719 Plumbing Piping Insulation 112/12/2024 PLUMBING 221116 Domestic Water Piping 112/12/2024 PLUMBING 221119 Domestic Water Piping Specialties 112/12/2024 PLUMBING 221316 Sanitary Waste and Vent Piping 112/12/2024 PLUMBING 221319 Sanitary Waste Piping Specialties 112/12/2024 PLUMBING 221413 Storm Drainage Piping 112/12/2024 PLUMBING 221423 Storm Drainage Piping Specialties 112/12/2024 PLUMBING 221429 Sump Pumps 112/12/2024 PLUMBING 223113 Water Conditioners 112/12/2024 PLUMBING 223300 Electric1 12/12/2024 PLUMBING 224000 Commercial Plumbing Fixtures 112/12/2024 PLUMBING 224713 Drinking Fountains and Water Coolers 112/12/2024 HVAC 230500 Common Work Results for Hvac 112/12/2024 HVAC 230513 Common Motor Requirements for Hvac Equipment 112/12/2024 HVAC 230514 Variable Speed Drives for HVAC Equipment 112/12/2024 HVAC 230517 Sleeves and Sleeve Seals for Hvac Piping 112/12/2024 HVAC 230518 Escutcheons for Hvac Piping 112/12/2024 HVAC 230519 Meters and Gages for Hvac Piping 112/12/2024 HVAC 230523 General-Duty for Hvac Piping 112/12/2024 HVAC 230529 Hangers and Supports for Hvac Piping and Equipment 112/12/2024 HVAC 230548.13 Vibration Controls for Hvac 112/12/2024 HVAC 230553 Identification for Hvac Piping and Equipment 112/12/2024 HVAC 230593 Testing1 12/12/2024 HVAC 230713 Duct Insulation 112/12/2024 HVAC 230716 Hvac Equipment Insulation 112/12/2024 HVAC 230719 Hvac Piping Insulation 112/12/2024 HVAC 230800 Commissioning of Hvac 112/12/2024 HVAC 230900 Instrumentation and Controls for Hvac 112/12/2024 HVAC 230993 Sequence of Operation for Hvac Controls 112/12/2024 HVAC 232113 Hydronic Piping 112/12/2024 HVAC 232116 Hydronic Piping Specialties 112/12/2024 HVAC 232123 Hydronic Pumps 112/12/2024 HVAC 233113 Metal Ducts 112/12/2024 HVAC 233116 Nonmetal Ducts 112/12/2024 HVAC 233300 Air Duct Accessories 112/12/2024 HVAC 233423 Hvac Power Ventilators 112/12/2024 HVAC 233713 Diffusers1 12/12/2024 HVAC 235213 Electric Boilers 112/12/2024 HVAC 237433 Dedicated Outdoor-Air Units 112/12/2024 HVAC 237905 Geothermal Heat Exchanger System 112/12/2024 HVAC 238146.13 Water-To-Air Heat Pumps 112/12/2024 HVAC 238239.19 Electric Wall and Ceiling Unit Heaters 112/12/2024 HVAC 238316 Radiant-Heating Hydronic Piping 112/12/2024 ELECTRICAL 260500 Common Work Results for Electrical 112/12/2024 ELECTRICAL 260519 Low-Voltage Electrical Power Conductors and Cables 112/12/2024 ELECTRICAL 260526 Grounding and Bonding for Electrical Systems 112/12/2024 ELECTRICAL 260529 Hangers and Supports for Electrical Systems 112/12/2024 ELECTRICAL 260533 Raceways and Boxes for Electrical Systems 112/12/2024 ELECTRICAL 260536.13 Non-Continuous Cable Supports for Electrical Systems 112/12/2024 ELECTRICAL 260543 Underground Ducts and Raceways for Electrical Systems 112/12/2024 ELECTRICAL 260544 Sleeves and Sleeve Seals for Electrical Raceways and Cabling 112/12/2024 ELECTRICAL 260553 Identification for Electrical Systems 112/12/2024 ELECTRICAL 260572 Short-Circuit Studies 112/12/2024 ELECTRICAL 260573 Coordination Studies 112/12/2024 ELECTRICAL 260574 Arc-Flash Hazard Analysis 112/12/2024 ELECTRICAL 260800 Commissioning of Electrical 112/12/2024 ELECTRICAL 260913 Electrical Power Monitoring and Control 112/12/2024 ELECTRICAL 260923 Lighting Control Devices 112/12/2024 ELECTRICAL 260943.03 Distributed Digital Lighting Controls 112/12/2024 ELECTRICAL 262213 Low-Voltage Distribution Transformers 112/12/2024 ELECTRICAL 262413 Switchboards 112/12/2024 ELECTRICAL 262416 Panelboards 112/12/2024 ELECTRICAL 262713 Electricity Metering 112/12/2024 ELECTRICAL 262719 Multi-Outlet Assemblies 112/12/2024 ELECTRICAL 262726 Wiring Devices 112/12/2024 ELECTRICAL 262743 Electric Vehicle Service Equipment - Ac Level 1 and 2 112/12/2024 ELECTRICAL 262813 Fuses 112/12/2024 ELECTRICAL 262816 Enclosed Switches and Circuit Breakers 112/12/2024 ELECTRICAL 262913.03 Manual and Magnetic Motor Controllers 112/12/2024 ELECTRICAL 263100 Photovoltaic Collectors 112/12/2024 ELECTRICAL 263323 Central Battery Equipment for Emergency Lighting 112/12/2024 ELECTRICAL 264313 Surge Protection for Low-Voltage Electrical Power Circuits 112/12/2024 ELECTRICAL 265119 LED Interior Lighting 112/12/2024 ELECTRICAL 265219 Emergency and Exit Lighting 112/12/2024 ELECTRICAL 265613 Lighting Poles and Standards 112/12/2024 ELECTRICAL 265619 LED Exterior Lighting 112/12/2024 COMMUNICATIONS 270500 Common Work Results for Communications Systems 112/12/2024 COMMUNICATIONS 270526 Grounding and Bonding for Communications Systems 112/12/2024 COMMUNICATIONS 270528 Pathways for Communications Systems 112/12/2024 COMMUNICATIONS 270543 Underground Pathways for Communications Systems 112/12/2024 COMMUNICATIONS 271000 Structured Cabling 112/12/2024 COMMUNICATIONS 271100 Communications Equipment Room Fittings 112/12/2024 COMMUNICATIONS 271300 Communications Backbone Cabling 112/12/2024 COMMUNICATIONS 271500 Communications Horizontal Cabling 112/12/2024 COMMUNICATIONS 271543 Communications Faceplates and Connectors 112/12/2024 COMMUNICATIONS 274100 Audiovisual Systems 112/12/2024 COMMUNICATIONS 275116 Public Address System 112/12/2024 COMMUNICATIONS 275119 Sound Masking System 112/12/2024 ELECTRONIC SAFETY 280500 Common Work Results for Electronic Safety and Security 112/12/2024 ELECTRONIC SAFETY 280510 Common Work Results for Electronic Security Systems 112/12/2024 ELECTRONIC SAFETY 281000 Electronic Security Systems 112/12/2024 ELECTRONIC SAFETY 281300 Access Control System 112/12/2024 ELECTRONIC SAFETY 281810 Intrusion Detection System 112/12/2024 ELECTRONIC SAFETY 282300 Video Surveillance System 112/12/2024 ELECTRONIC SAFETY 284123 Ip Intercom System 112/12/2024 ELECTRONIC SAFETY 284621.11 Addressable Fire-Alarm Systems 112/12/2024 EARTHWORK 310000 Earthwork 112/12/2024 EARTHWORK 311000 Building Demolition 112/12/2024 EARTHWORK 312333 Trenching and Backfilling 112/12/2024 EARTHWORK 316623 Aggregate Pier Foundation Systems 112/12/2024 EXTERIOR IMPROVEMENTS 320190 Tree Preservation and Protection 112/12/2024 EXTERIOR IMPROVEMENTS 321216 Asphalt Paving 112/12/2024 EXTERIOR IMPROVEMENTS 321313 Sitework Concrete 112/12/2024 EXTERIOR IMPROVEMENTS 321400 Unit Paving 112/12/2024 EXTERIOR IMPROVEMENTS 321540 Exterior Stone Surfacing and Features 112/12/2024 EXTERIOR IMPROVEMENTS 321543 Stabilized Aggregate Surfacing 112/12/2024 EXTERIOR IMPROVEMENTS 321723 Pavement Markings and Traffic Control 112/12/2024 EXTERIOR IMPROVEMENTS 323300 Site Furnishings 112/12/2024 EXTERIOR IMPROVEMENTS 329000 Planting 112/12/2024 EXTERIOR IMPROVEMENTS 329200 Turf Grasses 112/12/2024 EXTERIOR IMPROVEMENTS 329219 Native Grasses and Forbs Planting 112/12/2024 EXTERIOR IMPROVEMENTS 329643 Tree Transplanting 112/12/2024 UTILITIES 331100 Water Systems (Reference) 112/12/2024 UTILITIES 333213 Lift Stations 112/12/2024 UTILITIES 333500 Sewerage 112/12/2024 UTILITIES 334116 Subsoil Drainage 112/12/2024 UTILITIES 334300 Storm Water Filtration Practices 112/12/2024 UTILITIES 334400 Storm Water Separator Devices 112/12/2024 UTILITIES 334600 Storm Water Management Practices 112/12/2024 EXHIBIT G - List of Alternates1 Added Snow Melt 175,000$ 2Underground Ductwork at Multi-Purpose 185,000$ 3Additional Radiant Floor 84,000$ 4Not Used5 Ornilux Glazing at Select Locations 38,000$ 6Larger Deck Area 35,000$ All of the above Alternates are independent from each other. Alternates #Activity Name Orig. Dur'n Start Finish 1 Design & Pre-Construction 271 12-Dec-24 A 30-Jan-26 2 DD (GMP) Estimate 20 12-Dec-24 A 22-Jan-25 3 Construction Documents 60 23-Jan-25 16-Apr-25 4 City Counsel GMP Approval 14 23-Jan-25 11-Feb-25* 5 Onboard Geothermal Subcontractor 5 12-Feb-25 18-Feb-25 6 Onboard Mass Timber Supplier 5 12-Feb-25 18-Feb-25 7 Solicit and Award Long Lead Time Equipment 10 12-Feb-25 25-Feb-25 8 Onboard MEP Design Assist Partners 5 12-Feb-25 18-Feb-25 9 Subcontract Public Bid/Award 20 17-Apr-25 14-May-25 10 Building Permit 25 17-Apr-25 21-May-25 11 DOLI Approval 60 17-Apr-25 11-Jul-25 12 Geothermal Test Well (3-6 months to schedule)80 06-Oct-25*30-Jan-26 13 Procurement 180 19-Feb-25 31-Oct-25 14 Procure Structure (Mass Timber)160 19-Feb-25 03-Oct-25 15 Procure MEP Equipment 120 19-Feb-25 07-Aug-25 16 Procure Geothermal System - full system 130 19-Feb-25 21-Aug-25 17 Procure Medium-Volage Load Transfer 180 19-Feb-25 31-Oct-25 18 Procure Enclosure 50 15-May-25 25-Jul-25 19 Procure Finishes 80 15-May-25 08-Sep-25 20 Construction 331 03-Mar-25 19-Jun-26 21 Tree Removal (during inactive dates)25 03-Mar-25*04-Apr-25 22 Owner Move-out 15 20-Jun-25 11-Jul-25 23 Site Mobilization 10 07-Jul-25 18-Jul-25 24 Site Utilities 15 14-Jul-25 01-Aug-25 25 Install Temporary Barricades/Maintain Public Access to Trails 10 21-Jul-25 01-Aug-25 26 Demo Existing Facilities/Salvage Exterior Amenities 20 04-Aug-25 29-Aug-25 27 Geothermal System Install 30 22-Aug-25 03-Oct-25 28 Excavation/Earthwork 35 25-Aug-25 13-Oct-25 29 Deep Foundations/Footings 35 02-Sep-25 20-Oct-25 30 Mass Timber Structure 45 14-Oct-25 17-Dec-25 31 Excavate & Underground MEP 15 21-Oct-25 10-Nov-25 32 Enclosure 50 11-Nov-25 26-Jan-26 33 Interior Rough-in 60 18-Dec-25 16-Mar-26 34 Roofing 30 18-Dec-25 02-Feb-26 35 Interior Finishes 75 03-Feb-26 18-May-26 36 Solar Panels 30 03-Feb-26 16-Mar-26 37 Install MEP Equipment 15 03-Feb-26 23-Feb-26 38 Sitework & Landscaping 57 01-Apr-26*19-Jun-26 39 Green Roofing 30 01-May-26*12-Jun-26 40 Punchlist & Final Clean 20 19-May-26 16-Jun-26 41 Project Startup & Closeout 59 07-May-26 30-Jul-26 42 Project Startup & Energization 40 07-May-26 02-Jul-26 43 B3 Review & Certification 20 05-Jun-26 02-Jul-26 44 Substantial Completion 0 02-Jul-26 45 Owner Move-in & Training 19 06-Jul-26 30-Jul-26 46 Final Completion 0 30-Jul-26 Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan Feb Mar Apr May Jun Jul Aug Sep Oct Nov Dec Jan 2025 2026 2027 DD (GMP) Estimate Construction Documents City Counsel GMP Approval Onboard Geothermal Subcontractor Onboard Mass Timber Supplier Solicit and Award Long Lead Time Equipment Onboard MEP Design Assist Partners Subcontract Public Bid/Award Building Permit DOLI Approval Geothermal Test Well (3-6 months to schedule) Procure Structure (Mass Timber) Procure MEP Equipment Procure Geothermal System - full system Procure Medium-Volage Load Transfer Procure Enclosure Procure Finishes Tree Removal (during inactive dates) Owner Move-out Site Mobilization Site Utilities Install Temporary Barricades/Maintain Public Access to Trails Demo Existing Facilities/Salvage Exterior Amenities Geothermal System Install Excavation/Earthwork Deep Foundations/Footings Mass Timber Structure Excavate & Underground MEP Enclosure Interior Rough-in Roofing Interior Finishes Solar Panels Install MEP Equipment Sitework & Landscaping Green Roofing Punchlist & Final Clean Project Startup & Energization B3 Review & Certification Substantial Completion Owner Move-in & Training Final Completion 24-014-00 / Wood Lake Nature Center Building CURRENT / 01 - Project Layout Page 1 of 1 Milestone Pre-Construction Procurement Construction Progressed Project Summary Wood Lake Nature Center Building Schedule Update 1/10/25 Date Printed: 10-Jan-25 Layout: 01 - Project Layout TASK filter: Not Completed. City of RichfieldWood Lake Nature CenterRichfield, MNGuaranteed Maximum PriceSystem Cost per Cost per TotalUnits System GSF CostSubstructureFoundations17,00584.63$ 84.63$ 1,439,164$ ShellSuperstructure19,300135.54$ 153.83$ 2,615,942$ Exterior Enclosure16,46076.07$ 73.63$ 1,252,071$ Roofing19,30064.89$ 73.64$ 1,252,307$ InteriorsInterior Construction17,00566.38$ 66.38$ 1,128,762$ Interior Finishes17,00554.49$ 54.49$ 926,667$ ServicesPlumbing/HVAC17,005181.12$ 181.12$ 3,080,000$ Fire Protection17,00515.29$ 15.29$ 260,000$ Electrical17,005163.08$ 163.08$ 2,773,220$ Equipment & FurnishingsEquipment17,0052.00$ 2.00$ 34,091$ Furnishings17,0053.57$ 3.57$ 60,765$ SiteworkSite Preparation126,6450.54$ 3.99$ 67,846$ Site Improvements126,64514.09$ 104.90$ 1,783,825$ Site Civil / Mechanical Utilities126,6453.85$ 28.65$ 487,169$ General RequirementsGeneral Conditions17,00565.19$ 65.19$ 1,108,608$ Site Services17,00552.95$ 52.95$ 900,404$ Subtotal Construction Cost1,127.36$ 19,170,841$ Building Permit148,403$ Subtotal19,319,244$ Escalation0.00%-$ Subtotal19,319,244$ Estimating / Construction Contingency4.00%772,770$ Subtotal20,092,013$ Subcontractor Default Insurance1.30%223,104$ Performance & Payment Bond 0.75% 155,077$ Builders Risk Insurance0.00%by OwnerGeneral Liability Insurances1.00%206,770$ Subtotal20,676,964$ Contractor's Fee 3.25%672,001$ Total Construction Cost21,348,965$ Preconstruction30,000$ Total Construction Cost w/ Precon21,378,965$ Cost per Gross Building Sq. Ft.1,255.45$ / GSFGross Building Square Footage17,005Total Site Area143,650Building Footprint Area17,005Net Site Area 126,645Adds/Alternates NOT in Scope AboveAlternate #1: Snow Melt….............................................................................................................................................................175,000$ Alternate #2: Underground Ductwork at Multi-Purpose ….............................................................................................................................................................185,000$ Alternate #3: Additional Radiant Floor ….............................................................................................................................................................84,000$ Alternate #5: Ornilux Glazing at Select Locations ….............................................................................................................................................................38,000$ Alternate #6: Deck Scope ….............................................................................................................................................................35,000$ Alternate #7: Amphitheater….............................................................................................................................................................IncludedBuilding System ComponentsFebruary 4, 20251 February 4, 2025City of RichfieldWood Lake Nature Center Richfield, MNGuaranteed Maximum PriceProject Qty: 17,005 GSF1DescriptionQuantity Unit Total$ $'s1FOUNDATIONS2 Reinforcing Bars3 Reinforcing Steel Material, Grade 6046.88ton1,331.0162,3914 Reinforcing Steel Install46.88 ton 1,025.00 48,0475Reinforcing Bars Total --110,4387 Structural Concrete8 C001 - Misc. Concrete Items1.00lsum53,482.0053,4829 C122 - Pad Footings58.22 cy 1,142.58 66,52110 C152 - Strip Footings102.80cy905.7093,10611 C172 - Foundation Piers20.19 cy 4,833.14 97,58112 C176 - Misc. Foundation Piers29.00cy2,390.5969,32713 C210 - Foundation Walls10,688.00 sf 38.07 406,93914 C600 - Slab on Grade16,625.00sf20.22336,16615Structural Concrete Total - - 1,123,12217 Sheet Waterproofing18 Modified Bituminous Sheet Waterproofing 60mil <WP-6>5,250.00 sf 5.38 28,21919 OT Due to Incliment Weather1.00lsum2,000.002,00020Sheet Waterproofing Total - - 30,21922 Special Foundations23 Aggregate Piers - Footings1.00 lsum 120,385.00 120,38524 Aggregate Piers - Slab1.00lsum28,000.0028,00025 Layout by Aggregate Pier Installer1.00 lsum 8,000.00 8,00026 Additional Load Testing1.00lsum6,000.006,00027 Spoils Removal1.00 lsum 5,000.00 5,00028 Covering of man holes1.00lsum2,000.002,00029 Rock Base1.00 lsum 6,000.00 6,00030Special Foundations Total --175,38532FOUNDATIONS Total - - 1,439,16434SUPERSTRUCTURE35 Structural Steel Framing36 Structural Steel - Interior Column Locations10.00ton13,194.66131,94737 Structural Steel - Deck Post Connection Hardware2.00 ton 13,194.66 26,38938 BIM Coordination1.00lsum4,000.004,00039 Multiple Mobilizations1.00 lsum 3,000.00 3,00040 Structural Steel - Heavy Timber Connection Hardware - Included in GluLam -note--41Structural Steel Framing Total - tons - 165,33643 Wood Framing44 SW6 - Sheer Wall - 2x6- note - -45 2x6 Framed Wall8,431.00sf19.99168,54746 1/2" CD Framing Plywood8,432.00 sf 10.74 90,60147 Lumber Column 4 - 2x69.00ea447.494,02748 Sheer Wall 2- note - -49 2x8 Framed Wall349.00sf21.347,44650 1/2" CD Framing Plywood349.00 sf 10.74 3,75051 Interior Wall A4a-note--52 2x4 Framed Wall281.00 sf 17.97 5,05153 Interior Wall A4f-note--54 2x4 Framed Wall64.00 sf 17.97 1,15055 Interior Half Wall - A4i-note--56 2x4 Framed Wall180.00 sf 17.97 3,23557 Interior Wall - A6a-note--58 2x6 Framed Wall6,585.00 sf 19.99 131,64359 1/2" CD Framing Plywood - Display Wall780.00sf10.748,38160 Interior Wall A8a- note - -61 2x8 Framed Wall361.00sf21.347,70262 Interior Wall B3a- note - -63 2x4 Framed Wall80.00sf17.971,43864 Interior Wall B4a- note - -65 2x4 Framed Wall970.00sf17.9717,43566 Interior Wall B6a- note - -67 2x6 Framed Wall874.00sf19.9917,47268 Interior Wall C6a- note - -69 2x6 Framed Wall2,924.00sf19.9958,45570 CLear Lite Walls- note - -71 2x8 Framed Wall600.00sf41.7225,03272 1/2" CD Framing Plywood600.00 sf 23.12 13,86973 Door Headers-note--74 2x12 Header- 3x - Mech Door7.00 lf 58.14 40775 2x4 Header840.00lf7.326,15276 Window Headers- note - -77 2x4 Header552.00lf7.324,04378 2x6 Header552.00 lf 9.68 5,34279 2x8 Header552.00lf11.496,34480 2x4 Horizontal Framing - Utility Yard Screenwall1,200.00 lf 5.08 6,09981 2x8 Pressure Treated - Utility Yard Screenwall665.00lf6.134,07482 Joist Install- note - -83 2x8 Joist - Office Area (12)112.00lf9.901,10984 2x12 Joist - Office and Mech (273)3,414.00 lf 14.14 48,27685 8x6 Post - Utility Yard Screenwall30.00ea1,100.2033,00686 Roof Sheathing- note - -87 3/4" CD Framing Plywood4,945.00sf10.4151,46388 Roof Sheathing- note - -89 2x12 WD-12 Trellis874.00lf11.6310,16290Wood Framing Total - - 741,71392 Glue-Laminated Construction93 Material --- Glue Lam. Structure Columns, Beams, CLT Roof & Shear Walls1.00 lsum 1,193,000.00 1,193,00094 Labor --- Glue Lam. Structure Columns, Beams, CLT Roof & Shear Walls1.00lsum410,000.00410,00095 Beams - incl - -96 Beam - 3.125" x 12" Gluelam-incl--97 Beam - 3.125" x 15" Gluelam- incl - -98 Beam - (2) 3.125 + 1/2" x 15" Gluelam-incl-- February 4, 2025City of RichfieldWood Lake Nature Center Richfield, MNGuaranteed Maximum PriceProject Qty: 17,005 GSF2DescriptionQuantity Unit Total$ $'s99 Beam - 5.125" x 6" Gluelam - High-incl--100 Beam - 5.125" x 12" Gluelam- incl - -101 Beam - 5.125" x 15" Gluelam-incl--102 Beam - 6.75" x 12" Gluelam- incl - -103 Beam - 6.75" x 13.5" Gluelam-incl--104 Beam - 6.75" x 15" Gluelam- incl - -105 Beam - 6.75" x 16.5" Gluelam - Sloped Up-incl--106 Beam - 6.75" x 18" Gluelam- incl - -107 Beam - 6.75" x 19.5" Gluelam-incl--108 Beam - 6.75" x 24" Gluelam - High- incl - -109 Beam - 6.75" x 24" Gluelam-incl--110 Beam - 8.75" x 8" Gluelam- incl - -111 Beam - 8.75" x 15" Gluelam-incl--112 Beam - 8.75" x 15" Gluelam - Low- incl - -113 Beam - 8.75" x 18" Gluelam-incl--114 Beam - 8.75" x 19.5" Gluelam- incl - -115 Beam - 8.75" x 24" Gluelam - HIgh-incl--116 Beam - 8.75" x 24" Gluelam- incl - -117 Beam - 8.75" x 26" Gluelam - HIgh-incl--118 Beam - 8.75" x 30" Gluelam- incl - -119 Beam - 8.75" x 30" Gluelam - Low-incl--120 Columns- incl - -121 C1 - Glulam 8 3/4x6 Column - Architectural Finish-incl--122 C2 - Glulam 8 3/4x6 Column - Industrial Finish- incl - -123 C3 - Glulam 5 1/2 x 7 1/2 Column - Framing - In wall-incl--124 C6 - Glulam 8 3/4x7 1/2 - Industrial FInish- incl - -125 C7 - Glulam 8 3/4x7 1/2 - Architectural FInish-incl--126 Flitch Beams- incl - -127 FB1 - (2) Gluelam 5 1/8"x24" +++ (1) Steel Plate 1" x 23.5"-incl--128 FB2 - (2) Gluelam 5 1/8"x25" +++ (1) Steel Plate 1 1/4" x 25" - High- incl - -129 FB3 - (2) Gluelam 5 1/8"x20" +++ (1) Steel Plate 1 1/4"x20" - High-incl--130 FB4 - (2) Gluelam 5 1/8"x22" +++ (1) Steel Plate 1 1/4"x22" - High- incl - -131 FB5 - (2) glulam 5 18" x 25 1/2" +++ (1) Steel Plate 1 1/4" x 25" -incl--132 CLT/DLT- incl - -133 Glue Lam. Struc. Wood CLT Panels - 100 sf ea and 15,150 total sf-incl--134 HSS Pedestals/Foundation 1and 2/S802- incl - -135Glue-Laminated Construction Total --1,603,000137 Composite Decking138 Composite Lumber Decking <PLC-1> - 5-1/2" W (10% waste incl.) - Supply6,125.00lf9.7059,409139 Composite Lumber Decking <PLC-1> - 12" W (10% waste incl.) - Supply185.00 lf 18.62 3,445140 Composite Lumber Decking <PLC-1> - 5-1/2" W (10% waste incl.) - Install6,125.00lf2.5315,498141 Composite Lumber Decking <PLC-1> - 12" W (10% waste incl.) - Install185.00 lf 3.37 624142 Deck Framing2,315.00sf11.6326,918143Composite Decking Total - - 105,894145SUPERSTRUCTURE Total--2,615,942147 EXTERIOR ENCLOSURE148 Vapor Retarders149 Vapor-Permeable Sheet Membrane Air Barrier <AB-11>10,350.00 sf 8.35 86,473150 Multiple Mobilizations1.00lsum3,000.003,000151Vapor Retarders Total - - 89,473153 Siding154 Thermally Modified Wood 1"x6" vert TOung and Grove - Interior/Exterior Ceilings2,576.00 sf 24.36 62,747155 Thermally Modified Wood 1"x6" bom., vert tongue and groove solid wood planks - Delta Millworks, ThermoWood Spruce, HD Clear <SDNG-1>5,400.00sf24.36131,535156 Thermally Modified Wood 1"x6" bom., vert tongue and groove solid wood planks - Delta Millworks, ThermoWood Spruce, Historic Brown <SDNG-2> 3,340.00 sf 24.36 81,357157 Thermally Modified Wood 1"x6" bom., vert tongue and groove solid wood planks - Delta Millworks, ThermoWood Spruce, Historic Brown, soffit3,000.00sf24.3673,075<SDNG-2>158 Thermally Modified Wood 1"x6" bom., vert tongue and groove solid wood planks - Delta Millworks, ThermoWood Spruce, Historic Brown, sceenwall 1,210.00 sf 24.36 29,474<SDNG-2>159 Thermally Modified Wood 1"x6" bom., vert tongue and groove solid wood planks - Delta Millworks, LunaWood Duo, HD Clear <SDNG-3>1,910.00sf24.3646,524160Siding Total - - 424,711162 Joint Sealants163 Sealants & Caulking (Enclosure)16,460.00 sf 0.75 12,345164Joint Sealants Total --12,345166 Metal Doors & Frames167 H.M. Door, Frame & Hardware - Single Exterior Pkg3.00set7,482.3122,447168 H.M. Door, Frame & Hardware - Double Exterior Pkg4.00 set 12,752.08 51,008169Metal Doors & Frames Total --73,455171 Entrances172 Single Alum. Entrance Door w/ Hardware <AL DR>8.00ea8,475.8967,807173 Alum. Door Hardware- incl - -174 Double Alum. Entrance Doors w/ Hardware <AL DR>6.00pair16,951.78101,711175Entrances Total - - 169,518177 Storefronts178 Aluminum-Framed Glazing Systems <AFS-1>2,810.00 sf 110.84 311,456179 Temporary Protection1.00lsum10,000.0010,000180 Early Mobilization for Mock-Up1.00 lsum 3,000.00 3,000181 Forklift, Rough Terrain-9,000# Rental3.00mnth4,889.5014,669182 Forklift EOE900.00 gal 5.97 5,372183 Forklift Operator (9 Hr/day)12.00week4,569.4454,833184Storefronts Total - - 399,330186 Access Control Hardware187 Auto Door Operator, Swinging - Single3.00 ea 6,519.91 19,560188 Auto Door Operator, Swinging - Pair5.00ea11,735.8558,679189 Construction Cores1.00 lsum 5,000.00 5,000190Access Control Hardware Total --83,239192EXTERIOR ENCLOSURE Total 2,810.00 sf 445.58 1,252,071194ROOFING February 4, 2025City of RichfieldWood Lake Nature Center Richfield, MNGuaranteed Maximum PriceProject Qty: 17,005 GSF3DescriptionQuantity Unit Total$ $'s195 Rough Carpentry196 2x6 Roof Blocking @ Roof Hatch15.00 lf 10.69 160197 2x8 Ext. Blocking <WD-BLKG-1>1,250.00lf13.2716,586198 2x12 Ext. Blocking <WD-BLKG-1>2,500.00 lf 15.94 39,849199 3/4" Ext. Plywood <WD SHTG-1>6,725.00sf7.2348,612200Rough Carpentry Total - - 105,208202 Natural Roof Coverings203 Vegetative Roofing System <VEGR-1>4,575.00 sf 91.55 418,848204 Hot-fluid applied ruberized asphalt membrane-note--205 Plywood Sheathing, Root Barrier, Drainage Panels, Insulation, Protection Board- note - -206Natural Roof Coverings Total --418,848208 Elastomeric Membrane Roofing209 EPDM Membrane Roofing <EPDM-1>14,725.00sf34.05501,459210 Inclement Weather OT1.00 lsum 9,150.18 9,150211 Roofing Design Revisions1.00lsum18,300.3518,300212 Temporary Protection1.00 lsum 4,575.09 4,575213Elastomeric Membrane Roofing Total --533,485215 Sheet Metal Flashing & Trim216 Sheet Metal Flashing <SMF-1> - Roof1,450.00lf64.3393,273217 Sheet Metal Flashing <SMF-1> - Screenwall165.00 lf 70.30 11,600218 Sheet Metal Flashing <SMF-4>900.00lf95.0085,500219Sheet Metal Flashing & Trim Total - - 190,372221 Roof Accessories222 Roof Hatch 2'-6"x8'-0" <RH-1>1.00 ea 4,394.47 4,394223Roof Accessories Total --4,394225ROOFING Total 19,300.00 sf 64.89 1,252,307227INTERIOR CONSTRUCTION228 Misc. Metal Fabrications229 MET FAB-31-incl17,500.00-230 MET FAB-34- incl 17,500.00 -231 MET FAB-35-incl17,500.00-232 MET FAB-5- incl 17,500.00 -233Misc. Metal Fabrications Total ---235 Metal Stairs236 Ships Ladder Stair w/ Railing <MET FAB-1>15.00rise489.167,337237Metal Stairs Total - - 7,337239 Rough Carpentry240 2x4 Int. Blocking350.00 lf 12.06 4,219241 2x6 Int. Blocking400.00lf12.474,989242 2x8 Int. Blocking400.00 lf 12.71 5,085243 2x10 Int. Blocking250.00lf16.614,152244 2x12 Int. Blocking300.00 lf 17.08 5,125245Rough Carpentry Total --23,570247 Architectural Wood Casework248 P-Lam. Base Cabinets50.00lf590.5529,528249 P-Lam. Base Cabinets - Island10.00 lf 590.55 5,906250 P-Lam. Base Cabinets with Trash Bin Sliding (4 Total sets)38.00lf590.5522,441251 P-Lam. Half Wall Wrap - Office65.00 lf 590.55 38,386252 P-Lam.Removable Shroud - Bathrooms2.00lf674.731,349253 WD-1 Fire Place Base15.00 lf 388.90 5,834254 P-Lam. Wall Cabinets42.00lf511.1721,469255 WD-1 - Fire Place Storage Shelving 10.00 lf 316.04 3,160256 SSF-1 - 24" Dp. Countertop - Gilasi Glass Counter5.00lf469.552,348257 SSF-1 - 24" Dp. Countertop - Gilasi Glass Counter - Fire Place Sill15.00 lf 469.55 7,043258 SSF-1 - 24" Dp. Countertop - Gilasi Glass Counter - Reception Desk10.00lf469.554,696259 SSF-1 - 24" Dp. Countertop - Gilasi Glass Counter - Wall Cap16.00 lf 469.55 7,513260 SSF-2 - 24" Dp. Countertop - Silestone88.00lf469.5541,321261 SSF-2 - 24" Dp. Countertop - Silestone - FLoating5.00 lf 469.55 2,348262 SSF-2 - 24" Dp. Countertop - Silestone - SInk5.00lf469.552,348263 SSF-2 - 24" Dp. Countertop - Silestone - Wall Cap31.00 lf 469.55 14,556264 SSF-2 - 24" Dp. Countertop - Silestone -Island10.00lf469.554,696265 Reception Desk - AST-553.00 sf 65.68 3,481266 Reception Desk - Custom, Wood Veneer30.00lf1,466.8144,004267 Bench 24"D With Cushion + Storage24.00 lf 340.65 8,176268 Cubbies - Lockable4.00ea734.652,939269 Locker - P-Lam. 24" W, Lockable Storage Overhead Cabinet5.00 ea 1,923.03 9,615270 Custom Single Tier Plastic Laminate Locker5.00ea734.653,673271 Floor Prep and Cleaning1.00 lsum 4,905.22 4,905272 Ski and Pole Wall Storage Rack16.00lf508.788,141273 Temp Protection1.00 lsum 3,270.94 3,271274 Wall Prep1.00lsum1,635.471,635275Architectural Wood Casework Total - - 304,780277 Wood Frames278 WD-002 Wood Frame Single27.00 ea 1,780.35 48,069279 Wood Frame Double2.00ea2,503.435,007280 WD-012 Wood Sidelight Frame2.00 ea 4,573.83 9,148281 WD- 102Wood Transom Frame1.00ea4,573.834,574282 WD-112 Wood Sidelight Frame and Transom8.00 ea 4,573.83 36,591283 Add for Premium Grade Wood44.00sf43.381,909284 Add for Pre-Finishing Wood44.00 ea 86.77 3,818285 Unload / Sort Wood Frames42.00ea16.87708286Wood Frames Total - - 109,824288 Joint Sealants289 Sealants & Caulking (Interior Construction)17,005.00 gsf 0.30 5,102290Joint Sealants Total --5,102292 Metal Doors & Frames February 4, 2025City of RichfieldWood Lake Nature Center Richfield, MNGuaranteed Maximum PriceProject Qty: 17,005 GSF4DescriptionQuantity Unit Total$ $'s293 H.M. Door, Frame & Hardware - Single Interior Pkg ( 3'6"x7'6")4.00 set 7,167.22 28,669294 H.M. Door, Frame & Hardware - Double Interior Pkg (6'x7'6")4.00set13,018.6952,075295 H.M. Door, Frame & Hardware - Double Interior Pkg (8'x8'6")1.00 set 13,018.69 13,019296 Setting Door Prep and Staging1.00lsum4,984.014,984297Metal Doors & Frames Total - - 98,746299 Wood Doors300 Wood Door, SC 2-8x7-68.00 ea 1,926.84 15,415301 Wood Door, SC 3-0x7-618.00ea1,926.8434,683302 Wood Door, SC 3-0x7-6 - Double doors 4.00 ea 1,926.84 7,707303 Wood Door, SC 3-6x7-69.00ea2,187.1419,684304 Wood Door, SC 4-0x7-65.00 ea 2,187.14 10,936305 Door and Frame Touch Ups1.00lsum3,323.473,323306 Door Protection1.00 lsum 1,661.73 1,662307 Unload / Sort Wood Doors44.00ea16.87742308Wood Doors Total - - 94,153310 Access Doors & Panels311 24"x24" Drywall Access Panel17.00 ea 148.12 2,518312Access Doors & Panels Total --2,518314 Door Hardware315 Wood Door Install Hardware - Single Interior Set42.00set334.2114,037316 Wood Door Install Hardware - Double Interior Set2.00 set 445.16 890317Door Hardware Total --14,927319 Glass Glazing320 Millwork Glazing - Front - Doors Sliding - Top View30.00sf110.843,325321 Wood Door - GL-10 - (6)76.50 sf 45.64 3,491322 Wood Door - Gl-16 - (11)113.08sf45.645,161323 Wood Door Side Lites - 10150.00 sf 45.64 6,846324 Wood Door Transom - 8 40.00sf45.641,826325Glass Glazing Total - - 20,649327 Plaster & Gypsum Board Assemblies328 Furred 5/8" Gyp. Bd. w/ Insulation25,190.00 sf 7.60 191,337329Plaster & Gypsum Board Assemblies Total --191,337331 Painting332 Paint Ships Ladder/Rails1.00set1,500.001,500333Painting Total - - 1,500335 Visual Display Units336 Markerboards 8'x4'1.00 ea 1,618.37 1,618337 Tackboards 8'x4'2.00ea733.331,467338Visual Display Units Total - - 3,085340 Signage341 Interior Signage Allowance17,005.00 gsf 0.75 12,754342Signage Total --12,754344 Partitions345 Accordion Folding Partition763.00sf155.27118,470346 Soffit Protection1.00 lsum 2,443.00 2,443347 Structure coordination1.00lsum1,221.001,221348Partitions Total - - 122,134350 Wall & Door Protection351 WGC-1 - Corner Guard - 8' Stainless Steel6.00 ea 383.51 2,301352 WGC-2 - Corner Guard - 4' Vinyl Surface Mtd.15.00ea161.572,424353 Fiberglass Reinforced Wall Panels2,401.00 sf 7.60 18,237354Wall & Door Protection Total --22,962356 Toilet, Bath, & Laundry Accessories357 ICS-1 - Diaper Changing Table - Plastic2.00ea1,002.092,004358 Seat-1 - Child Seat Bathroom11.00 ea 1,002.09 11,023359 Step-1 - Child Step - Bathroom11.00ea1,002.0911,023360 ACS-1 - Adult Changing Table - Stainless1.00 ea 3,302.75 3,303361 18" Grab Bar10.00ea154.971,550362 36" Grab Bar3.00 ea 172.58 518363 42" Grab Bar10.00ea179.181,792364 Drying Rack1.00 ea 275.29 275365 PTC-1 - Paper Towel Dispenser4.00ea462.521,850366 CH-2 - Robe Hook64.00 ea 81.55 5,219367 CH-1 - Double Robe Hook10.00ea77.15771368 Sanitary Napkin Disposal11.00 ea 440.50 4,846369 SHCR-1 - Shower Curtain Rod & Hooks1.00ea341.61342370 SHFS-1Shower Seat1.00 ea 1,321.32 1,321371 SDISP-2 - Soap Dispenser - Surface Mtd.4.00ea253.361,013372 TPH-1 - Toilet Paper Holder13.00 ea 220.34 2,864373 Mir-1 - 29"x21" Framed Mirror12.00ea330.423,965374 Mir-2 - 21"x60" Framed Mirror3.00 ea 1,035.11 3,105375 Layout1.00lsum652.99653376 Storage and Sorting1.00 lsum 2,614.37 2,614377 US-1 - Stainless Steel Shelf Mtd. on Stall Wall11.00ea715.887,875378 US-2 - Stainless Steel Shelf Mtd. on Stall Wall8.00 ea 715.88 5,727379 Wall Prep1.00lsum1,960.181,960380Toilet, Bath, & Laundry Accessories Total - - 75,614382 Manufactured Fireplaces383 Manufactured Fireplace <MFPL-2>1.00 ea 7,500.00 7,500384Manufactured Fireplaces Total --7,500386 Fire Protection Specialties387 Fire Extinguisher & Cabinet2.00ea807.491,615388 Knox Box3.00 ea 1,321.32 3,964389Fire Protection Specialties Total --5,579 February 4, 2025City of RichfieldWood Lake Nature Center Richfield, MNGuaranteed Maximum PriceProject Qty: 17,005 GSF5DescriptionQuantity Unit Total$ $'s391 Storage Assemblies392 Metal Storage Shelving32.00 lf 51.44 1,646393Storage Assemblies Total --1,646395 Wardrobe & Closet Specialties396 Wire Closet & Utility Shelving80.00lf18.791,503397Wardrobe & Closet Specialties Total - - 1,503399 Audio-Visual Equipment400 TV Bracket2.00 ea 770.92 1,542401Audio-Visual Equipment Total --1,542403INTERIOR CONSTRUCTION Total 17,005.00 sf 66.38 1,128,762405INTERIOR FINISHES406 Board Paneling407 WD-1 Dodoge Veneers - Quartered ash, white wash820.00sf59.4548,752408 WD Fab -2 - Bead Board WD-1 With Top Tim225.00 sf 46.03 10,358409 WD Fab -2 - Bead Board WD-1 With Top Tim62.00sf46.032,854410Board Paneling Total - - 61,964412 Wood Paneling413 WD-1 Dodoge Veneers - Quartered ash, white wash300.00 sf 92.80 27,840414 WD-1 Wall Panels1,250.00sf92.80115,999415Wood Paneling Total - - 143,839417 Wood Trim418 3" Red Oak Window / Door Casing - Prefinished843.00 lf 13.57 11,439419Wood Trim Total --11,439421 Plaster & Gypsum Board Assemblies422 Gypsum Suspended Ceiling2,243.00sf10.3123,124423 Gyp. Suspended Ceiling Soffit250.00 sf 10.80 2,700424 Gyp. Suspended Ceiling Soffit - operable Partitions740.00sf15.1911,242425Plaster & Gypsum Board Assemblies Total - - 37,065427 Gypsum Board428 Glulam Clean up1.00 lsum 2,576.00 2,576429 Level 5 Finish Premium - Wall Surfaces750.00sf0.95712430 Misc Blocking/Framing - Soffits and Ceilings1.00 lsum 3,864.00 3,864431 Touch Up's1.00lsum1,288.001,288432Gypsum Board Total - - 8,440434 Thin-Set Tiling435 QT-1 Quarry Tile Floor - Thin Set217.00 sf 14.88 3,228436 CTF-1 Ceramic Tile Floor - Thin Set810.00sf15.7312,738437 QTB-1 Quarry Tile Base - Thin Set43.00 lf 15.62 672438 CTW-1 Ceramic Tile Wall - Thin Set2,547.00sf17.2243,870439 CTW-2 Ceramic Tile Wall - Thin Set1,202.00 sf 17.22 20,703440 CTW-3 Ceramic Tile Wall - Thin Set450.00sf17.227,751441 FTRS-2 - Z Profile Stainless Edge81.00 lf 20.22 1,638442 FTRS-3 Schluter Transition Strip120.00lf20.222,426443 Gyp Patching1.00 lsum 1,075.00 1,075444 Schluter Transition Strip450.00lf14.886,695445 Tile Cleaning1.00 lsum 537.00 537446 Wall and Floor Prep1.00lsum1,612.001,612447Thin-Set Tiling Total - - 102,945449 Waterproofing-Membrane Tiling450 Crack isolation Membrane under floor tile820.00 sf 5.51 4,515451Waterproofing-Membrane Tiling Total --4,515453 Acoustical Ceilings454 ACT-1 24"x24"x1" SNL White NRC .95 with ROckfon 9/16" tempra 4000 WHite Grid1,995.59sf2.474,926455 ACTR-1 Rockfon Infinity CDX 6" white Trim83.00 lf 13.99 1,161456Acoustical Ceilings Total --6,087458 Acoustical Ceiling Suspension Assemblies459 AST-1A 1 inch THink Fixed High Impact Fabric Wrapped glass fiber board 728.00sf12.759,279460 AST-1B 1 inch THink Fixed High Impact Fabric Wrapped glass fiber board 438.00 sf 41.97 18,382461 AST-1c 1 inch THink Fixed High Impact Fabric Wrapped glass fiber board 1,251.00sf41.9752,502462 AST-2 Filzfelt 3mm thick - direct glue186.00 sf 41.97 7,806463 AST-3 - Acoufelt 1" on Wood Furring Strips - Clouds 2,560.00sf41.97107,438464 AST-3 - ACoufelt 1" thick - Walls - Beam Pockets644.00 sf 41.97 27,027465 AST-4 - TUff Drop Acoustic Ceiling Baffel - Reception 166.00sf41.976,967466 AST-5 - Millwork Desk186.00 sf 41.97 7,806467 Glulam Prep1.00lsum1,255.001,255468 Material Protection1.00 lsum 2,510.00 2,510469 MEP Coordination1.00lsum3,765.003,765470Acoustical Ceiling Suspension Assemblies Total - - 244,738472 Floor Treatment473 Con Fin-5 Concrete Floor Sealer3,330.00 sf 2.44 8,136474 Glulam Protection1.00lsum1,818.001,818475 Trade Coordination1.00 lsum 909.00 909476 Con Fin-13 Polished Concrete Floor Finish2,509.00sf7.7119,344477Floor Treatment Total - - 30,207479 Resilient Flooring480 Entry Mats - FL MAT 1310.00 sf 76.88 23,832481 Entry Mats - FL MAT 21,805.00sf12.7823,066482 Entry Mats - FL MAT 3120.00 sf 18.97 2,276483 Entry Mats - FL MAT 4229.00sf18.974,343484 RB-1 Resilient Base - Profile 4" (sim Johnsonite Millwork)489.00 lf 14.45 7,067485 RB-2 Resilient Base - Profile 4" (sim Johnsonite Millwork)705.00lf14.4510,189486 RB-3 Resilient Base - Profile 4.5" (sim Johnsonite Millwork)919.00 lf 14.45 13,282487Resilient Flooring Total --84,055 February 4, 2025City of RichfieldWood Lake Nature Center Richfield, MNGuaranteed Maximum PriceProject Qty: 17,005 GSF6DescriptionQuantity Unit Total$ $'s489 Carpeting490 CPT-3 Sheet Carpeting10.00 sy 51.40 514491 RSF-1 - Nora rubber sheet foring unita 2MM191.00sy90.3317,253492 RSF-2 - Nora rubber sheet foring unita 2MM5.00 sy 90.33 452493 CPT-1 Carpet Tile223.00sy66.8214,900494 CPT-2 Carpet Tile270.00 sy 117.43 31,706495 Floor Prep - clean1.00lsum2,727.002,727496Carpeting Total - - 67,551498 Wall Covering499 VWC-1 Vinyl Wall Covering (CFCI) - Custom757.00 sf 17.77 13,451500 VWC-2 - Astek WC 0 Aviary AD 759-2 Jade on PVC free type 2 backing1,936.00sf17.7734,401501 VWC-3B - wall covering provide970.00 sf 2.71 2,633502 VWC-3C - wall covering provide1,106.00sf2.713,002503 VWC-4 - wall covering provide90.00 sf 2.71 244504Wall Covering Total --53,732506 Painting507 PT-1 Paint Gyp Brd Walls - 3 Coats (Primer, Intermediate, Topcoat)25,190.00sf1.0426,110508 Paint Gyp Brd Ceilings2,243.00 sf 1.09 2,436509 Paint Gyp Brd Soffits350.00sf1.72601510 Paint Exposed Structure - COlumns - 11 Count330.00 sf 2.45 810511 Paint HM Doors9.00ea108.80979512 Paint HM Frames4.00 ea 98.91 396513 Paint HM Frames (Double)5.00ea108.80544514 Paint Exposed Conduit Above Deck per Detail 2/5011.00 lsum 1,000.00 1,000515 Floor Protection1.00lsum1,227.001,227516 Glulam Protection1.00 lsum 1,840.00 1,840517 Trade Coordination1.00lsum613.00613518Painting Total - - 36,555520 Staining & Transparent Finishing521 Prep, Stain, Seal & Varnish - Trellis2,623.00 sf 11.78 30,897522Staining & Transparent Finishing Total --30,897524 Special Coatings525 Paint COnduit-note--526 Paint Fire Sprinkler Piping- note - -527 Paint MEP-note--528Special Coatings Total - - -530 Storage Assemblies531 WD-1 Floating Shelf22.00 lf 119.93 2,638532Storage Assemblies Total --2,638534INTERIOR FINISHES Total 17,005.00 sf 54.49 926,667536PLUMBING537 Plumbing/Mechanical/Geothermal538 Plumbing / Mechanical / Geothermal1.00lsum2,985,000.002,985,000539 Contractor Led BIM1.00 lsum 50,000.00 50,000540 Draintile diffuser coordination1.00lsum20,000.0020,000541 Expedite Geothermal System1.00 lsum 25,000.00 25,000542Plumbing/Mechanical/Geothermal Total --3,080,000544PLUMBING Total 17,005.00 sf 181.12 3,080,000546FIRE PROTECTION547 Fire Protection Systems548 Fire Suppression System1.00lsum250,000.00250,000549 BIM Coordination1.00 lsum 5,000.00 5,000550 Design changes1.00lsum2,500.002,500551 FM Global1.00 lsum 2,500.00 2,500552Fire Protection Systems Total --260,000554FIRE PROTECTION Total 17,005.00 sf 15.29 260,000556ELECTRICAL557 013 - Construction Utilities558 Building Temp Electrical Service1.00lsum18,500.0018,500559013 - Construction Utilities Total - - 18,500561 Electrical Systems562 Electrical Systems / Low Voltage1.00 lsum 1,676,000.00 1,676,000563 BIM Coordination1.00lsum50,000.0050,000564 PV Design Coordination1.00 lsum 15,000.00 15,000565 Switch Gear OT install1.00lsum25,000.0025,000566 Lighting Fixtures1.00 allw 377,000.00 377,000567 Access Control and Security1.00allw252,000.00252,000568 A/V, Speakers, Paging1.00 lsum 305,000.00 305,000569 Alternate #7: Amphitheater - Lighting, In-Ground Floor Boxes, Surveillance Camera1.00allw54,720.0054,720570Electrical Systems Total - - 2,754,720572ELECTRICAL Total17,005.00sf163.082,773,220574 EQUIPMENT575 Residential Appliances576 APPL-1 - Refrigerator1.00 ea 4,158.21 4,158577 APPL-11 - Refrigerator1.00ea4,158.214,158578 APPL-2 - Washer and Dryer1.00 ea 4,158.21 4,158579 APPL-4 - Refrigerator1.00ea4,158.214,158580 APPL-5 - Freezer1.00 ea 4,158.21 4,158581 APPL-7 - Refrigerator1.00ea4,158.214,158582 Appl-10 - Microwave1.00 ea 1,123.61 1,124583 APPL-8 - Range1.00ea2,561.052,561584 APPL-9 - Range Hoods1.00 ea 963.89 964585 APPL-3 Dishwasher1.00ea1,762.471,762 February 4, 2025City of RichfieldWood Lake Nature Center Richfield, MNGuaranteed Maximum PriceProject Qty: 17,005 GSF7DescriptionQuantity Unit Total$ $'s586 APPL-6 Dishwasher1.00ea1,762.471,762587 Coordination1.00 lsum 161.16 161588 Floor Prep1.00lsum484.67485589 Storage1.00 lsum 322.32 322590Residential Appliances Total --34,091592 Exhibit Equipment593 Exhibit Equipment <EXH EQ-1> - by Owner-nic--594Exhibit Equipment Total - - -596EQUIPMENT Total17,005.00sf2.0034,091598 FURNISHINGS599 Window Shades600 WT-1 - Rollershades - Manual - SWF COntract921.00 sf 17.59 16,200601 Coordination and Lay out1.00lsum304.00304602 Feild Measure1.00 lsum 911.00 911603 Vertical for Clear Lite - WT-2 Rollershades - Dual Shade / Blackout - Power300.00sf52.7715,830604 Wall Prep and Glulam Prep1.00 lsum 608.00 608605 WT-2 Rollershades - Dual Shade / Blackout - Power510.00sf52.7726,912606Window Shades Total - - 60,765608 Office Furniture609 ** Office Furniture **- nic - -610Office Furniture Total ---612 Seating613 ** Seating **-nic--614Seating Total - - -616FURNISHINGS Total17,005.00sf3.5760,765618 SPECIAL CONSTRUCTION619 Geotechnical Investigations620 Geotechnical Investigations - Generic Item- nic - -621Geotechnical Investigations Total ---623 Removal & Disposal of Contaminated Soils624 Removal & Disposal of Contaminated Soils -nic--625Removal & Disposal of Contaminated Soils Total - - -627 Underground Storage Tank Removal628 Underground Storage Tank Removal - nic - -629Underground Storage Tank Removal Total ---631 Asbestos Remediation632 Asbestos Abatement-nic--633Asbestos Remediation Total - - -635SPECIAL CONSTRUCTION Total17,005.00sf--637 SITE PREPARATION638 Building Demolition639 Mass Building Demolition1.00 lsum 67,845.56 67,846640Building Demolition Total --67,846642SITE PREPARATION Total 126,645.00 sf 0.54 67,846644SITE IMPROVEMENTS645 Decorative Metal Railing646 Decorative Railing - 42"H <DEC RAIL-1>185.00lf335.1762,006647 - Cable rail system, steel posts, steel top, w/ (1) exit only gate- note - -648Decorative Metal Railing Total --62,006650 Signage651 Exterior Signage Allowance1.00allw25,000.0025,000652 Donor Recognition Signage- nic - -653 Traffic Signage9.00ea846.197,616654Signage Total - - 32,616656 Excavation & Fill657 Excavation & Fill1.00 lsum 577,629.59 577,630658 CM Directed Overtime1.00lsum20,000.0020,000659 Inclement Weather/Related Site Preparation & Re-Grading1.00 lsum 20,000.00 20,000660Excavation & Fill Total --617,630662 Flexible Paving663 Additional Mobilizations1.00lsum3,000.003,000664 Bit. Paving 3.5" Asphalt / 8" Base3,995.00 sy 35.54 141,982665 Traffic Control1.00lsum1,500.001,500666Flexible Paving Total - - 146,482668 Rigid Paving669 6" Concrete Equipment Pad70.00 sf 36.36 2,545670 7" Concrete Pavement w/ Macro-Fiber Reinforcing2,520.00sf12.1230,543671Rigid Paving Total - - 33,088673 Unit Paving674 Precast Concrete Unit Paver <PVR-1>1,020.00 sf 17.00 17,340675Unit Paving Total --17,340677 Curbs, Gutters, Sidewalks, & Driveways678 4" Concrete Walk (w/o reinforcement)7,840.00sf9.7076,018679 D412 Curb & Gutter240.00 lf 24.24 5,818680 B612 Curb & Gutter1,310.00lf24.2431,755681Curbs, Gutters, Sidewalks, & Driveways Total - - 113,591 February 4, 2025City of RichfieldWood Lake Nature Center Richfield, MNGuaranteed Maximum PriceProject Qty: 17,005 GSF8DescriptionQuantity Unit Total$ $'s683 Paving Specialties684 Paint Stall93.00ea21.151,967685 Paint ADA Stall7.00 ea 25.39 178686 ADA Parking Sign Bollard - Install5.00ea606.013,030687 Additional Mobilizations1.00 lsum 3,000.00 3,000688 Temporary Protection/Repairs to Damaged Concrete1.00lsum1,500.001,500689Paving Specialties Total - - 9,675691 Retaining Walls692 Modular Block Retaining Wall720.00 sf 52.42 37,745693Retaining Walls Total --37,745695 Site Furnishings696 Bike Rack <FURN-1>3.00ea1,053.423,160697Site Furnishings Total - - 3,160699 Turf & Grasses700 **Landscape Lump Sum**1.00 lsum 517,957.00 517,957701 Water Truck During Planting1.00lsum10,000.0010,000702 Plant Protection Post Placement1.00 lsum 6,000.00 6,000703 Alternate #7: Amphitheater - Finsihes, Stonework1.00lsum176,535.00176,535704Turf & Grasses Total - - 710,492706SITE IMPROVEMENTS Total126,645.00sf14.091,783,825708 SITE CIVIL / MECHANICAL UTILITIES709 Water Utility Distribution Piping710 Site Utilities1.00 lsum 487,168.84 487,169711Water Utility Distribution Piping Total --487,169713SITE CIVIL / MECHANICAL UTILITIES Total 126,645.00 sf3.85 487,169715GENERAL REQUIREMENTS716 General Requirements717 General Requirements1.00lsum1,108,608.001,108,608718General Requirements Total - - 1,108,608720GENERAL REQUIREMENTS Total17,005.00sf65.191,108,608722 SITE SERVICES723 General Requirements724 Site Services1.00 lsum 900,404.00 900,404725General Requirements Total --900,404727SITE SERVICES Total 17,005.00 sf 52.95 900,404729ESTIMATE TOTAL17,005.00GSF1,127.3619,170,841 EXHIBIT K - List of Allowance1 Lighting Fixtures 377,000$ 2Access Control and Security 252,000$ 3A/V, Speakers and Paging 305,000$ All of the above Allowances are independent from each other. Allowances