Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
02-11-2020 Regular Agenda
R EG U LAR C IT Y C O U N C IL MEET IN G R IC H F IE L D MU N IC IPAL C E N TE R, C O U N C IL C H AMB E R S FE B R U ARY 11, 2020 7:00 P M R E G U L AR C ITY C O U N C IL ME E TIN G IN TR O D U C TO RY P R O C E E D IN G S C all to order P ledge of A llegiance Open forum E ach speaker is to keep their comment period to three minutes to allow sufficient time for others. C omments are to be an opportunity to address the C ouncil on items not on the agenda. I ndividuals who wish to address the C ouncil must have registered prior to the meeting. A pproval of the Minutes of the: (1) S pecial C oncurrent C ity C ouncil and Housing and Redevelopment A uthority Work S ession J anuary 21, 2020; (2) S pecial C ity C ouncil Work S ession J anuary 23, 2020; (3) C ity C ouncil Work S ession J anuary 28, 2020; and (4) C ity C ouncil Meeting J anuary 28, 2020. AG E N D A APPR O VAL 1.A pproval of the A genda 2.Consent Calendar contains several separate items, which are acted upon by the City Council in one motion. Once the Consent Calendar has been approved, the individual items and recommended actions have also been approved. No further Council action on these items is necessary. However, any Council Member may request that an item be removed from the Consent Calendar and placed on the regular agenda for Council discussion and action. All items listed on the Consent Calendar are recommended for approval. A .F irst reading of transitory ordinance providing funding for certain capital improvements from the S pecial Revenue F und. S taff Report No. 27 B .C onsider the adoption of a resolution authorizing acceptance of Office of Traffic S afety (OTS ) funds for a vehicle to be used for distracted driving enforcement. S taff Report No. 28 C .C ontinue consideration of land use applications for C hase B ank at Market P laza (6501 Woodlake D rive) to F ebruary 24, 2020. S taff Report No. 29 3.C onsideration of items, if any, removed from C onsent C alendar PR O P O S E D O R D IN AN C E S 4.C onsider approval of an ordinance, and summary publication of said ordinance, amending S ection 405 of the C ity C ode related to housing maintenance and adopting the International P roperty Maintenance C ode (IP MC ). S taff Report No. 30 O T H E R B U S IN E S S 5.C onsider the approval of agreements with non-profit organizations to provide social services to the C ity of Richfield and authorization of the C ity Manager to execute agreements with those agencies. S taff Report No. 31 C IT Y MAN AG E R’S R E P O R T 6.C ity Manager's Report C LAIMS AN D PAYR O L LS 7.C laims and P ayroll C O U N C IL D ISC U SSIO N 8.Hats Off to Hometown Hits 9.A djournment Auxiliary aids for individuals with disabilities are available upon request. Requests must be made at least 96 hours in advance to the City Clerk at 612-861-9738. CITY COUNCIL MEETING MINUTES Richfield, Minnesota Special Concurrent City Council and Housing and Redevelopment Authority Work Session January 21, 2020 CALL TO ORDER The work session was called to order by Chair Supple at 5:30 p.m. in the Bartholomew Room. Council Members Maria Regan Gonzalez, Mayor; Mary Supple; Simon Trautmann, and Ben Present Whalen. Council Members Edwina Garcia. Absent: HRA Members Mary Supple, Chair; Maria Regan Gonzalez; Sue Sandahl; and Present: Erin Vrieze Daniels. HRA Members Absent: Pat Elliott. Staff Present: Katie Rodriguez, City Manager; John Stark, HRA Executive Director/Community Development Director; Julie Urban, Housing Manager; Melissa Poehlman, Assistant Community Development Director; Neil Ruhland, Communication and Engagement Manager; Kate Aitchison, Housing/Communications Specialist; and LaTonia DuBois, Administrative Assistant. Others Present: Stephanie Ahles, HueLife; members of the community. Item #1 FACILITATED WORKSHOP ON AFFORDABLE HOUSING GOALS Chair Supple explained this is an interactive workshop and audio may be difficult at times. Housing Manager Julie Urban provided background information on affordable housing and introduced Stephanie Ahles of HueLife. Stephanie Ahles of HueLife explained the agenda and some objectives for the evening. Stephanie asked Policy Makers to introduce themselves and what type of housing they grew up in and asked them to describe what affordable housing looks like to each of them. Housing Manager Julie Urban provided a data review on affordable housing and presented data on affordable housing in Richfield. She explained how current policy is working, discussed accessibility and how affordability is determined by the Met Council. Concurrent Council and HRA Work Session -2- January 21, 2020 Stephanie explained the process for the evening and asked Policy Makers to answer several questions about what affordable housing looks like. Policy Makers discussed thoughts on the current affordable housing situation in Richfield and future goals and challenges. Policy Makers broke into groups and brainstormed and came up with similar objectives and areas of concern. Policy Makers came back together and shared their ideas and had conversations regarding housing goals and policies. Objectives were placed on a board and grouped into categories of similarity. A visual of the City Council and HRA affordable housing goals was pieced together and displayed on the board. Policy Makers discussed how to build on the goals with current policies and which objectives would have the biggest impact on the community and which of these they would consider of most significance. The themes agreed on were: preserve, protect and improve the quality of NOAH; have plenty of diverse options within affordable housing for all residents; fully integrate affordable housing into community and provide equitable access to all its amenities; and create proactive policies and tools to reach our vision for affordability and small business ownership. Chair Supple invited members of the community to join the Housing and Redevelopment meeting. ADJOURNMENT The work session was adjourned by unanimous consent at 7:00 p.m. Date Approved: February 11, 2020 Maria Regan Gonzalez Mayor LaTonia DuBois Katie Rodriguez Administrative Assistant City Manager CITY COUNCIL MEETING MINUTES Richfield, Minnesota Special City Council Work Session January 23, 2020 CALL TO ORDER The work session was called to order by Council Member Regan Gonzalez at 4:43 p.m. in the Babcock Room. Council Members Maria Regan Gonzalez, Mayor; Mary Supple; and Ben Whalen Present: Council Members Edwina Garcia; and Simon Trautmann Absent: Staff Present: Blanca Martinez Gavina, Executive Analyst Item #1 REVIEW OF BOARDS/COMMISSIONS APPLICATIONS Council Members discussed board and commission candidates for the City of Richfield. ADJOURNMENT The work session was adjourned by unanimous consent at 5:07 p.m. Date Approved: February 11, 2020 Maria Regan Gonzalez Mayor Kelly Wynn Katie Rodriguez Senior Office Assistant City Manager CITY COUNCIL MEETING MINUTES Richfield, Minnesota City Council Work Session January 28, 2020 CALL TO ORDER The work session was called to order by Mayor Maria Regan Gonzalez at 5:45 p.m. in the Bartholomew Room. Council Members Maria Regan Gonzalez, Mayor; Edwina Garcia; Mary Supple; Present: and Ben Whalen. Council Members Simon Trautmann Absent: Staff Present: Katie Rodriguez, City Manager; Chris Regis, Finance Director; Mike LaFond, Utility Billing Clerk; Russ Lupkes, Utilities Engineer; Jack Broz, Transportation Engineer; and Blanca Martinez Gavina, Executive Analyst. Others Present: April Crockett, MnDOT Metro District, West Area Manager; and Aaron Tag, MnDOT West Area Engineer Item #1 MNDOT PRESENTATION OF INFORMATION ON HIGHWAY 5 RECONSTRUCTION PROJECT FOR APRIL 2020 TO NOVEMBER 2020. City Manager Rodriguez introduced the item for discussion along with the members presenting the information. MnDOT West Area Engineer, Aaron Tag, gave an overview of the project scope including multiple bridge repairs within terminal one interchange, project staging and detours. He then described the three stages involved beginning in April and concluding in September. Aaron also spoke of how this project differs from their usual ones due to the frequent use of the corridor and 20 to 30 percent of that use is airport travelers. These users may be from out of the area/state and not familiar with alternate routes. He continued on to clarify the entrance and exit to Terminal 1 from Highway 5. Council Member Supple asked about the detour and crosstown (Highway 62) and whether it is working effectively to handle the detour process. MnDOT West Area Engineer, Aaron Tag, stated there will be additional congestion but there are a number of areas within Highway 62 that will be marked as three lanes instead of two. He continued to explain they will advertise a three prong approach to communications: (1) Know before Council Work Session -2- January 28, 2020 you go; (2) Informed travel decision; and (3) Real time travel information to ensure the public has all the necessary information. Council Member Garcia asked if the information would be on the City website. Transportation Engineer Broz confirmed there will be a strong push to all available communication channels during reconstruction. MnDOT West Area Engineer, Aaron Tag, discussed the timeline for the project and what the ‘around the airport’ website will have in terms of content. Council Member Whalen asked about the additional 25 minutes to the travel routes and if that is with or without the mitigation. Aaron confirmed that is with the mitigation of lanes. Mayor Regan Gonzalez asked about other specific problem areas and being able to prepare those areas for the expected delays. MnDOT West Area Engineer, Aaron Tag, explained they are attempting to prepare backup plans in case delays are worse than expected. Transportation Engineer Broz spoke of the communication with staff and residents and there will be various types of outreach. Council Member Supple inquired if the project will impact the Fort Snelling Historical Society. MnDOT West Area Engineer, Aaron Tag, stated they have had meetings with the Historical Society and the worry is during the April-May months regarding school tours. They will be working together to make sure all necessary information is being provided to schools before their arrival to allow school buses required time for any delays. Mayor Regan Gonzalez thanked Richfield staff, along with Aaron and April, for their time and energy as well as the continued communication around the project. Item #2 CONSIDERATION OF IMPLEMENTING OWNER ONLY UTILITY BILLING City Manager Rodriguez introduced the item for discussion and staff presenting. Director Regis spoke to the need to solve issues around communication and a way to be more transparent. He continued to state the responsible party will be receiving the bill instead of renters. Director Regis also stated that traditionally, property owners come to prefer this process because it puts them in control. It is the hope this process will also reduce cost and time spent by employees to remedy incorrect billing. Council Member Supple asked if this owner only billing concept is only applicable to single family homes that are rented. Director Regis confirmed that it will only be applicable to single family homes, duplexes, and commercial buildings. Utility Billing Clerk LaFond spoke to how in larger units, they are billed as one unit. Council Member Whalen agrees with the process but expressed frustration about a trend in which the experience for renters can be perceived as an afterthought. He approves with moving forward with the process but would like to ensure that the experience of residents is the priority of consideration. Director Regis confirmed that the process will be no different from what our current renters are used to currently. Council Work Session -3- January 28, 2020 City Manager Rodriguez stated the owners can also be a resident and this procedure is a way to enforce the City billing process as it created consistency. Council Member Garcia asked if the property manager would decide how much each resident pays and how it is divided. Director Regis explained this would be for rented properties that most likely have individual meters and renters can request a statement of bills to see how much they will be expected to pay. City Manager Rodriguez clarified the owner will have the option of adding the utility to the rent or send it directly to the renter. Council Member Garcia agreed this process seems to be fairer. City Manager Rodriguez summarized the key aspects in which there should be an inclusion of the impact on renters in future staff reports but overall there seemed to be a positive response to move forward with owner only billing. Mayor Regan Gonzalez agreed. ADJOURNMENT The work session was adjourned by unanimous consent at 6:31 p.m. Date Approved: February 11, 2020 Maria Regan Gonzalez Mayor Kelly Wynn Katie Rodriguez Senior Office Assistant City Manager CALL TO ORDER The meeting was called to order by Mayor Maria Regan Gonzalez at 7:00 p.m. in the Council Chambers. Council Members Maria Regan Gonzalez, Mayor; Edwina Garcia; Mary Supple; and Present: Ben Whalen. Council Members Simon Trautmann Absent: Staff Present: Katie Rodriguez, City Manager; Mary Tietjen, City Attorney; Neil Ruhland, Communications Manager; Jay Henthorne, Police Chief; Mike Flaherty, Public Safety Deputy Chief; Jamie Maiser, Public Safety Administrative Aid; Jennifer Anderson, Support Services Supervisor; and Blanca Martinez Gavina, Executive Analyst. PLEDGE OF ALLEGIANCE Mayor Regan Gonzalez led the Pledge of Allegiance APPROVAL OF MINUTES Mayor Regan Gonzalez spoke of the adjustments made to the list of Council liaisons to local, regional, and city boards and commissions. These changes are reflected online. M/Supple, S/Whalen to approve the minutes of the: (1) City Council Work Session for January 08, 2020; (2) Special City Council Work Session of January 11, 2020; (3) City Council Work Session of January 14, 2020; (4) City Council Meeting of January 14, 2020; and (5) Special City Council Work Session of January 16, 2020. Motion carried 4-0. Item #1 APPROVAL OF THE AGENDA CITY COUNCIL MEETING MINUTES Richfield, Minnesota Regular Council Meeting January 28, 2020 Council Meeting Minutes -2- January 28, 2020 M/Supple, S/Garcia to remove item #5 from the agenda and approve remaining agenda items. Motion carried 4-0. Item #2 CONSENT CALENDAR City Manager Rodriguez presented the consent calendar. A. Consider the approval of a Temporary On-Sale Intoxicating Liquor license for the Church of St. Peter, located at 6730 Nicollet Avenue South, for their Ham Bingo event taking place on March 28, 2020 (Staff Report No. 15) B. Consider the approval of a Temporary On-Sale Intoxicating Liquor license for the Church of St. Peter, located at 6730 Nicollet Avenue South, for their Spaghetti Dinner event taking place on February 16, 2020 (Staff Report No. 16). C. Consider the adoption of a resolution appointing election judges for the Presidential Nomination Primary of March 3, 2020 and approval of the absentee ballot board for the 2020 Election cycle (Staff Report No. 17). RESOLUTION NO. 11711 RESOLUTION APPOINTING ELECTION JUDGES FOR THE PRESIDENTIAL NOMINATION PRIMARY OF MARCH 3, 2020 AND APPROVAL OF THE ABSENTEE BALLOT BOARD FOR THE 2020 ELECTION CYCLE D. First reading of an ordinance amending Section 405 of the City Code related to housing maintenance and adopting the International Property Maintenance Code (IPMC) (Staff Report No. 18). E. Consider the approval of a Construction and Maintenance Agreement with Morrie's Richfield JRL RE, LLC (Morrie's Jaguar Land Rover) that defines ownership and maintenance responsibilities for certain features constructed at 1525 East 77th Street (Staff Report No. 19). F. Consider the approval of a Construction and Maintenance Agreement with NOVO, LLC that defines ownership and maintenance responsibilities for certain features constructed at 2400 West 66th Street (Staff Report No. 20). G. Consider the approval of a Construction and Maintenance Agreement with Chamberlain Apartments, LLC that defines ownership and maintenance responsibilities for certain features constructed at 6630, 6700, and 6701 Richfield Parkway (Staff Report No. 21). M/Garcia, S/Supple to approve the consent calendar Council Meeting Minutes -3- January 28, 2020 Motion carried 4-0. Item #3 CONSIDERATION OF ITEMS, IF ANY, REMOVED FROM CONSENT CALENDAR None Item #4 CONSIDER APPROVAL OF AN ORDINANCE REZONING PROPERTY AT 6501 WOODLAKE DRIVE (MARKET PLAZA/VILLAGE SHORES). CONSIDER APPROVAL OF A RESOLUTION GRANTING AN AMENDMENT TO THE MARKET PLAZA/VILLAGE SHORES PLANNED UNIT DEVELOPMENT TO ALLOW A NEW BUILDING FOR A BANK BRANCH WITH A DRIVE-UP ATM. CONSIDER APPROVAL OF A RESOLUTION GRANTING A SUBDIVISION WAIVER TO ALLOW THE CREATION OF A SEPARATE LOT FOR THE PROPOSED BUILDING (STAFF REPORT NO. 22) Council Member Whalen read Staff Report 22. Director Stark reviewed the rezoning designation and proposed building plans for the area. Council Member Whalen suggested to separate the three items under consideration. M/Whalen, S/Supple to approve an ordinance rezoning property at 6501 Woodlake Drive (Market Plaza/Village Shores). Motion carried 4-0 M/Whalen, S/Supple to approve a resolution granting an amendment to the Market Plaza/Village Shores planned unit development to allow a new building for a bank branch with a drive- up ATM. Council Member Whalen expressed his disappointment that the pedestrian path the developer agreed too on the west side of the building has not been included in the plans. He also had concerns about the grade of the lot and wondered of any options including ramps to include a more accessible building. David Knaeble, Project Manager, spoke to the sidewalk connection to the property on the west side and showed the proposed plan. He also addressed the grading for the parking lot and the options considered. Mayor Regan Gonzalez questioned why there is a proposed drive through ATM for the bank instead of in the entrance of the building. Terron Wright, Architect, poke to the convenience of a drive through ATM for customers but it can be discussed with the company to have it not included in the build. Council Meeting Minutes -4- January 28, 2020 Council Member Whalen wondered if the grade problems would be a concern with any proposed development for this property. Director Stark suggested that depending on the needs of a building, some of the issues could be mitigated. Mayor Regan Gonzalez requested to table this item and revisit in two weeks. She would like to see the staff discuss with the developer all the grading issues, the drive through ATM, and the parking agreement with Hennepin Health. Director Stark proposed further discussion on ways that these issues can be accommodated. M/Whalen, S/Supple to withdraw approval of a resolution granting an amendment to the Market Plaza/Village Shores planned unit development to allow a new building for a bank branch with a drive-up ATM. M/Regan Gonzalez, S/Garcia to table to (1) Consider approval of a resolution granting an amendment to the Market Plaza / Village Shores planned unit development to allow a new building for a bank branch with a drive-up ATM; and (2) Consider approval of a resolution granting a subdivision waiver to allow the creation of a separate lot for the proposed building. Motion carried 4-0 RESOLUTION NO. 11712 RESOLUTION APPROVING AN AMENDED FINAL DEVELOPMENT PLAN AND CONDITIONAL USE PERMIT FOR A PLANNED UNIT DEVELOPMENT AT 6501 WOODLAKE DRIVE RESOLUTION NO. 11713 RESOLUTION AUTHORIZING A SUBDIVISION WAIVER FOR MARKET PLAZA AND VILLAGE SHORES AT 6501 WOODLAKE DRIVE Item #5 CONSIDER THE APPROVAL OF A RESOLUTION AUTHORIZING THE LAWFUL GAMBLING PREMISES PERMIT FOR MINNEAPOLIS-RICHFIELD AMERICAN LEGION POST #435, 6501 PORTLAND AVE SOUTH (STAFF REPORT NO. 23) M/Supple, S/Garcia to remove item from the agenda per the request of the Minneapolis- Richfield American Legion Post #435. Motion carried 4-0 Item #6 CONSIDER A RESOLUTION TO SUPPORT THE COORDINATED CENSUS EFFORTS AND FUNDING TO ENSURE THAT ALL RICHFIELD RESIDENTS ARE COUNTED IN THE 2020 CENSUS (STAFF REPORT NO. 24) Council Meeting Minutes -5- January 28, 2020 Council Member Garcia presented Staff Report 24. She spoke of the coordinated efforts in the whole county and if a good count is not taken, a loss of representation in Congress could occur. She also addressed some of the fears around the Census such as status and immigration. Mayor Regan Gonzalez thanked Executive Analyst, Blanca Martinez Gavina, for her efforts in leading to prepare for the 2020 Census. M/Garcia, S/Supple to consider a resolution to support the coordinated Census efforts and funding to ensure that all Richfield residents are counted in the 2020 Census. RESOLUTION NO. 11710 RESOLUTION SUPPORTING THE RICHFIELD COUNTS 2020 CENSUS EFFORTS Motion carried 4-0. Item #7 VIOLATION HEARING AND CONSIDERATION OF A RESOLUTION REGARDING CIVIL ENFORCEMENT FOR ESTABLISHMENTS THAT RECENTLY UNDERWENT ALCOHOL COMPLIANCE CHECKS CONDUCTED BY RICHFIELD PUBLIC SAFETY STAFF AND FAILED BY SELLING ALCOHOL TO UNDERAGE YOUTH (STAFF REPORT NO. 25) Mayor Regan Gonzalez presented Staff Report 25. M/Supple, S/Garcia to approve a resolution regarding civil enforcement for (1) El Tejaban Mexican Grill; (2) La Vaquita 2; and (3) Giordano’s of Richfield that recently underwent alcohol compliance checks conducted by Richfield Public Safety staff, and failed by selling alcohol to underage youth. Ehrick Halland, Reginal Manager of Giordano’s of Richfield, introduced himself, explained the occurrence with the employee, and admitted to the violation. Wendy, General Manager of El Tejaban Mexican Grill, admitted to the violation and discussed the steps they will be taking to not allow this to happen again. Support Services Supervisor Anderson spoke with the representative for La Vaquita 2 before she had to leave the Council meeting and they have admitted to the claims and will endure the pentalties put forth by the Council. Motion carried 4-0. RESOLUTION NO. 11715 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR EL TEJABAN MEXICAN RESTAURANT, LLC. d/b/a EL TEJABAN MEXICAN GRILL, 6519 NICOLLET AVENUE SOUTH, AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE RESOLUTION NO. 11716 Council Meeting Minutes -6- January 28, 2020 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR JIMENEZ GENAO, LLC. d/b/a LA VAQUITA 2, 607 77TH STREET EAST, AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE RESOLUTION NO. 11717 RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR VPC RICHFIELD PIZZA, LLC. d/b/a GIORDANO’S OF RICHFIELD, 3000 66th STREET WEST, AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE Item #8 CONSIDER THE APPOINTMENTS TO CITY ADVISORY BOARDS AND COMMISSIONS (STAFF REPORT NO. 26) Mayor Regan Gonzalez read Staff Report 26. M/Garcia, S/Whalen to consider appointments to fill mid-term or vacant positions to City advisory boards and commissions. Council Member Garcia described how they received many applicants for the positions. People are very excited to serve their community. Council Member Whalen expressed his gratitude to all the residents that applied, which were about 50 applicants. He is excited to see so many wonderful residents wanting to shape the future of the community. Council Member Supple echoed the thank you to all the residents for applying. Mayor Regan Gonzalez also thanked all the applicants and staff for taking time to participate. She addressed the changes that have been made in order to better accommodate the high number of residents that would like to serve. Motion carried 4-0. Item #9 CITY MANAGER’S REPORT City Manager Rodriguez had nothing to report. Item #10 CLAIMS AND PAYROLL Council Meeting Minutes -7- January 28, 2020 M/Garcia, S/Whalen that the following claims and payrolls be approved: U.S. Bank 01/28/2020 A/P Checks 284088 - 284500 $ 1,278,117.79 Payroll: 151786 - 152115 745,552.53 TOTAL $ 2,023,670.32 Motion carried 4-0. OPEN FORUM Wilmery Quinones, sister of Brian Quinones, stated that she is tired of coming to Council meetings and continually asking for the same things. She also mentioned her family still lives in Richfield and she hates coming to visit them. Oscar Colera believes changes need to be made and Council should be serving the people. Mayor Regan Gonzalez stated the investigation regarding Brian Quinones is being conducted by Hennepin County and the City has been in full cooperation. She would also like to see a conclusion and has urged Hennepin County to expedite their decision. Isis Eby, St. Paul resident, does not believe she is safe when she comes to Richfield. She would like the officers involved in the Brian Quinones case to be taken off the streets. Keith McCarron, Minneapolis resident, wants to know if mental health crisis is a crime and would like to know if the police officers have a procedure to deal with mental health. Maria Rosario, mother of Brian Quinones, expressed how much pain she has gone through. Paul Bosman, Minneapolis resident and Lawyer, believes the City is withholding data in regards to the squad car video. Don Williams, Minnesota resident, read the oxford definition of homicide, the mission of Richfield’s Police Department and his stated his disappointment in the department not living up to their mission. He demanded the Mayor and Council members build trust and review the process and add body cameras and release data that has been requested. Chara Blanch, Richfield resident, discussed her frustration with the City of Richfield and her perceived lack of compliance and demanded the dash camera footage from the officer involved shooting is released. She also spoke about how she does not feel safe in Richfield, fears for her son, and has contemplated moving. She addressed the need for body cameras to be implemented this year. Item #11 HATS OFF TO HOMETOWN HITS Council Meeting Minutes -8- January 28, 2020 None Item #12 ADJOURNMENT The meeting was adjourned by unanimous consent at 8:47 p.m. Date Approved: February 11, 2020 Maria Regan Gonzalez Mayor Kelly Wynn Katie Rodriguez Senior Administrative Assistant City Manager AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.A. STAFF RE P ORT NO. 27 CIT Y COUNCIL ME E T ING 2/11/2020 RE P O RT P RE PA RE D B Y: C hris Regis, F inance D irector D E PA RTME NT D IRE C TO R RE V IE W: C hris Regis, F inance D irector O THE R D E PA RTM E NT RE V IE W: N/A . C ITY MA NA G E R RE V IE W: K atie Rodriguez 2/5/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: First reading of transitory ordinance providing funding for certain capital improvements from the Special Revenue Fund. E X E C UT IV E S UM M ARY: As part of the Capital I mprovement Budget and annual City Budget process, certain special revenue funds are allocated each year to fund capital projects identified through the budget process. The source of the special revenue funds are profits derived from the City’s Liquor Store operation. These profits are transferred to the Liquor Contribution Special Revenue Fund. Before the funds within the Special Revenue Fund can be used for the identified capital projects, the City Charter requires that a transitory ordinance be used to authorize the expenditure of the funds. I n addition, the ordinance process allows for public input through a public hearing. The proposed funding for 2020 totals $450,000 and encompasses several park and recreation related projects. RE C O M M E ND E D AC T I O N: By Motion: Approve first reading of the transitory ordinance providing for the expenditure of funds from the Special Revenue Fund for certain capital improvements, schedule public hearing and second reading for March 10, 2020. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T At the December 10, 2019 City Council meeting, the City Council authorized $450,000 of Special Revenue Funds for improvements to several City capital improvements in 2020. I ncluded in the $450,000 are: $50,000 for Major Park Maintenance Projects/Fence Repair $50,000 Community Center/Wood Lake Building Repair $180,000 Augsburg Park Play Equipment $85,000 Madison Park Play Equipment $85,000 W ashington Park Play Equipment The 2020 Capital I mprovement Budget also provides for expenditures for all types of funds contained in the budget including municipal state aid, user fees, state grants, county funds, and issuance of debt. Authorization by ordinance is not required for expenditures other than Special Revenues. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): City Charter Section 7.12, Subd. 2 requires that Special Revenue Funds used for capital improvements must be authorized by ordinance. This process provides for public input through a public hearing. C.C R IT IC AL T IMIN G IS S U E S: Under Section 3.09 of the City Charter, a transitory ordinance becomes effective 30 days after publication of the second hearing notice. The ordinance requirements must be completed early enough in 2020 so that the capital projects can be initiated on a timely basis, completed and the funds expended. I t is suggested that the first reading of the transitory ordinance take place on February 11, 2020 and a public hearing and second reading be completed at the March 10, 2020 City Council meeting. D.F IN AN C IAL IMPAC T: W hile the total 2020 Capital I mprovements Budget (C I B) includes total budgeted expenditures of $18,285,980 the portion of C I B concerning proposed funding from the Special Revenue fund is 450,000. Major Park Maintenance Projects/Fence Repair $50,000 Community Center/Wood Lake Building Repair $50,000 Augsburg Park Play Equipment $180,000 Madison Park Play Equipment $85,000 Washington Park Play Equipment $85,000 A transitory ordinance is necessary to finalize the appropriations utilizing special revenue funds pursuant to City Charter. The source of Special Revenue funds is municipal liquor profits. E.L E GAL C ON S ID E R AT ION: The City Charter requires that a transitory ordinance be used to authorize the expenditure of Special Revenue funds. ALTE R N AT IV E R E C O MME N D ATIO N(S): The City Council could postpone the first reading of the transitory ordinance to a future City Council meeting. The City Council could decide to authorize none or only a portion of the expenditures identified from special revenue in the C I B. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None. AT TAC H ME N T S: D escription Type 2020 Transitory Ordinance Ordinance BILL NO. TRANSITORY ORDINANCE NO. AN ORDINANCE PROVIDING FOR THE EXPENDITURE OF MONEY FROM THE SPECIAL REVENUE FUND FOR CERTAIN CAPITAL IMPROVEMENTS CITY OF RICHFIELD DOES ORDAIN: Section 1: It is found and determined to be necessary and expedient for the City to expend money from the Special Revenue Fund for the making of capital improvements listed in Section 2 hereof, for which the City would be authorized to issue general obligation bonds. Section 2: The capital improvements and amounts of expenditures for such improvements which are authorized to be paid from the Special Revenue Fund under Section 7.12, Subdivision 2 of the City Charter, are as follows: Major Park Maintenance/Fence Repair $ 50,000 Community Center/Wood Lake Building Repair $ 50,000 Augsburg Park Play Equipment $ 180,000 Madison Park Play Equipment $ 85,000 Washington Park Play Equipment $ 85,000 Section 3: The expenditures herein authorized shall be made pursuant to such contracts as are authorized from time to time by Council action. Passed by the City Council of the City of Richfield this 11th day of February, 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.B. STAFF RE P ORT NO. 28 CIT Y COUNCIL ME E T ING 2/11/2020 RE P O RT P RE PA RE D B Y: Jay Henthorne, D irector of P ublic S afety/C hief of P olice D E PA RTME NT D IRE C TO R RE V IE W: Jay Henthorne, D irector of P ublic S afety/C hief of P olice 2/4/2020 O THE R D E PA RTM E NT RE V IE W: C ITY MA NA G E R RE V IE W: K atie Rodriguez 2/5/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the adoption of a resolution authorizing acceptance of Office of Traffic Safety (O T S) funds for a vehicle to be used for distracted driving enforcement. E X E C UT IV E S UM M ARY: The National Highway Traffic Safety Administration (NHTS A) is providing federal funding to the OTS to implement a program to support distracted driving enforcement. The grant is administered through the OTS. The City of Richfield has been awarded $94,100.00 for 2020. RE C O M M E ND E D AC T I O N: By motion: Adopt a resolution allowing the Richfield Department of Public Safety to accept a grant from the Office of Traffic Safety (O T S) to fully fund a vehicle for enforcement of distracted driving. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T Richfield Police Department is part of a multi-jurisdictional Federal Fiscal Year 2020, Towards Zero Death Enforcement Grant that includes: Airport Police Department, Bloomington Police Department, Hopkins Police Department, Edina Police Department, Eden Prairie Police Department St. Louis Park Police Department. Richfield Police Department will purchase and equip the vehicle with grant funding, to be used for distracted driving enforcement. The vehicle will be stored at the Richfield Police Department when not in use. From 2013-2017 in Hennepin County, 25 people died as a result of inattention in traffic crashes The economic impact of these inattention related deaths was $29,262,000. There were 199 total traffic deaths during this time in Hennepin County. The economic impact of total deaths was $298,896,000. There were 193 people seriously injured as a result of inattention in traffic crashes during this time. The economic impact of these injuries was $15,953,200. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): Public Safety does not accept financial support unless it is designated for a specific program that will affect the department as a whole. The grant money will be used by Public Safety to pay for one vehicle and any remaining funds can be used to conduct overtime distracted driving enforcement. Minnesota Statute 465.03 requires that every acceptance of a grant or devise of real or personal property on terms prescribed by the donor be made by resolution of more than two-thirds majority of the City Council. The Administrative Services Department issued a memo on November 9, 2004, requiring that all grants and restricted donations to departments be received by resolution and by a two-thirds majority of the City Council in accordance with Minnesota Statute 465.03. C.C R IT IC AL T IMIN G IS S U E S: N/A D.F IN AN C IAL IMPAC T: The Richfield Department of Public Safety has developed a work plan and budget that have been approved by the OTS. The grant will cover the purchase of a vehicle and any remaining funds can be used to conduct overtime distracted driving enforcement by all agencies in the grant. A joint powers agreement will be executed on behalf of the participating jurisdictions to help cover fuel and maintenance costs for the duration of the grant. E.L E GAL C ON S ID E R AT ION: There are no legal considerations. ALTE R N AT IV E R E C O MME N D ATIO N(S): Council could disapprove the acceptance of the grant but the Richfield Department of Public Safety would than not be able to purchase a vehicle for inattentive or distracted driving enforcement. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None AT TAC H ME N T S: D escription Type A greement C ontract/A greement Resolution Resolution L etter Grant Agreement Page 1 of 2 DPS Grant Agreement non-state (OTS 06/16) Minnesota Department of Public Safety (“State”) Office of Traffic Safety 445 Minnesota St. Suite 1620 St. Paul, Minn. 55101-2190 Grant Program: 2020 NHTSA Funding RFP: Distracted Driving Truck Project No.: 20-04-11 Grant Agreement No.: A-TRUCK20-2020-RICHFPD-002 Grantee: Richfield Police Department 6700 Portland Ave. South Richfield, Minn., 55423 Grant Agreement Term: Effective Date: Jan. 20, 2020 Expiration Date: Sept. 30, 2020 Grantee’s Authorized Representative: Sgt. Matt Steen Richfield Police Department 6700 Portland Ave. South Richfield, Minn., 55423 Phone: (612) 861-9800 E-mail: msteen@richfieldmn.gov Grant Agreement Amount: Original Agreement $ 94,100.00 Matching Requirement $ 0.00 State’s Authorized Representative: Shannon Grabow Office of Traffic Safety 445 Minnesota St. Suite 1620 St. Paul, Minnesota 55101-2190 Phone: (651) 201-7063 E-mail: shannon.grabow@state.mn.us Federal Funding: CFDA #20.600 FAIN: 18X9204020MN17 State Funding: None Special Conditions: None Under Minn. Stat. § 299A.01, Subd 2 (4) the State is empowered to enter into this grant agreement. Term: Effective date is the date shown above or the date the State obtains all required signatures under Minn. Stat. § 16B.98, subd. 7, whichever is later. Once this grant agreement is fully executed, the Grantee may claim reimbursement for expenditures incurred pursuant to the Payment clause of this grant agreement. Reimbursements will only be made for those expenditures made according to the terms of this grant agreement. Expiration date is the date shown above or until all obligations have been satisfactorily fulfilled, whichever occurs first. The Grantee, who is not a state employee will: Perform and accomplish such purposes and activities as specified herein and in the Grantee’s approved 2020 NHTSA Funding RFP: Distracted Driving Truck Application (“Application”) which is incorporated by reference into this grant agreement and on file with the State at Office of Traffic Safety, 445 Minnesota St., Suite 1620, St. Paul, Minn. 55101. The Grantee shall also comply with all requirements referenced in the 2020 NHTSA Funding RFP: Distracted Driving Truck Guidelines and Application which includes the Terms and Conditions and Grant Program Guidelines (https://app.dps.mn.gov/EGrants), which are incorporated by reference into this grant agreement. Budget Revisions: The breakdown of costs of the Grantee’s Budget is contained in Exhibit A, which is attached and incorporated into this grant agreement. As stated in the Grantee’s Application and Grant Program Guidelines, the Grantee will submit a written change request for any substitution of budget items or any deviation and in accordance with the Grant Program Guidelines. Requests must be approved prior to any expenditure by the Grantee. Matching Requirements: (If applicable.) As stated in the Grantee’s Application, the Grantee certifies that the matching requirement will be met by the Grantee. Grant Agreement Page 2 of 2 DPS Grant Agreement non-state (OTS 06/16) Payment: As stated in the Grantee’s Application and Grant Program Guidance, the State will promptly pay the Grantee after the Grantee presents an invoice for the services actually performed and the State's Authorized Representative accepts the invoiced services and in accordance with the Grant Program Guidelines. Payment will not be made if the Grantee has not satisfied reporting requirements. Certification Regarding Lobbying: (If applicable.) Grantees receiving federal funds over $100,000.00 must complete and return the Certification Regarding Lobbying form provided by the State to the Grantee. 1. ENCUMBRANCE VERIFICATION 3. STATE AGENCY Individual certifies that funds have been encumbered as required by Minn. Stat. §§ 16A.15 and 16C.05. Signed: ___________________________________________ (with delegated authority) Signed: _____________________________________________ Title: ______________________________________________ Date: _______________________________________________ Date: ______________________________________________ Grant Agreement No. A-TRUCK20-2020-RICHFPD-002 PO No. 3-65155 2. GRANTEE The Grantee certifies that the appropriate person(s) have executed the grant agreement on behalf of the Grantee as required by applicable articles, bylaws, resolutions, or ordinances. Signed: _____________________________________________ Print Name: __________________________________________ Title: _______________________________________________ Date: _______________________________________________ Signed: ______________________________________________ Print Name: __________________________________________ Distribution: DPS/FAS Title: ______________________________________________ Grantee State’s Authorized Representative Date: _______________________________________________ RESOLUTION NO. RESOLUTION AUTHORIZING THE DEPARTMENT OF PUBLIC SAFETY/POLICE TO ACCEPT GRANT MONIES FROM THE OFFICE OF TRAFFIC SAFETY IN THE AMOUNT OF $94,100.00 OR A LESSER AMOUNT, AS AWARDED BY THE DEPARTMENT OF PUBLIC SAFETY, TO FUND A VEHICLE FOR DISTRACTED DRIVING ENFORCEMENT. WHEREAS, Richfield Police Department has been approved by the Office of Traffic Safety (OTS) to receive funds made through federal funding provided by the National Highway Traffic Safety Administration (NHTSA); and WHEREAS, Richfield is scheduled to be awarded $94,100.00 or a lesser amount as awarded by the Minnesota Department of Public Safety to be used as designated by the grant agreement which mandates that the a vehicle dedicated to distracted driving enforcement, and a joint powers agreement with multi-jurisdictions; WHEREAS, Richfield has agreed that the Minnesota Department of Public Safety will serve as the fiscal agent; and, WHEREAS, in accordance with the agreement, squad operating costs per mile, maintenance, will be covered by the Richfield Department Public Safety; and, WHEREAS, Richfield Police has established an approved budget with the OTS for $94,100.00 or a lessor amount for the distracted driving enforcement program; and, NOW, THEREFORE, BE IT RESOLVED that the City of Richfield, Public Safety Department enter into a grant agreement with the Minnesota Department of Public Safety, for traffic safety enforcement projects during the period from January 20, 2020 to September 30, 2020. Adopted by the City Council of the City of Richfield, Minnesota this 11th day of February, 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.C. STAFF RE P ORT NO. 29 CIT Y COUNCIL ME E T ING 2/11/2020 RE P O RT P RE PA RE D B Y: Matt B rillhart, A ssociate P lanner D E PA RTME NT D IRE C TO R RE V IE W: John S tark, C ommunity D evelopment D irector 2/5/2020 O THE R D E PA RTM E NT RE V IE W: C ITY MA NA G E R RE V IE W: K atie Rodriguez 2/5/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Continue consideration of land use applications for Chase Bank at Market Plaza (6501 W oodlake Drive) to February 24, 2020. E X E C UT IV E S UM M ARY: Civil Site Group ("Applicant") has submitted plans for a Chase Bank building with a drive-up ATM in the parking lot of Market Plaza, on the northwest corner of Lyndale Avenue and 66th Street. On J anuary 28, 2020, the City Council tabled consideration of the proposed development to the next meeting on February 11. The Applicant has requested that the Council delay consideration of the proposal until February 24, so that they may continue to work on resolving the issues and questions raised by the Council at the J anuary 28 meeting. RE C O M M E ND E D AC T I O N: By motion: Continue consideration of land use applications for Chase Bank at Market Plaza to February 24, 2020. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T N/A B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): N/A C.C R IT IC AL T IMIN G IS S U E S: 60-D AY RUL E : The 60-day clock 'started' when a complete application was received on November 29, 2019. Due to the long gap between the Planning Commission meeting and City Council consideration, staff informed the Applicant that the City was extending the timeline for a decision by 30 days. A decision is required by February 27, 2020, or the Council must notify the applicant that it is extending the deadline for issuing a decision by 30 additional days (120 days total - March 28, 2020). I f a decision is reached at the Council meeting on February 24, no further extension will be necessary. D.F IN AN C IAL IMPAC T: None. E.L E GAL C ON S ID E R AT ION: A public hearing was held before the Planning Commission on December 9, 2019. Notice of the public hearing was mailed to properties within 350 feet of the proposed development and published in the Sun Current newspaper. The Planning Commission voted (4-2) to recommend approval of the development plans. On J anuary 28, the Council approved an ordinance rezoning the Market Plaza property from Planned Multifamily Residential (P MR) to Planned Mixed Use (P MU). The Council tabled consideration of land use applications to subdivide the property (Subdivision W aiver) and to amend the Market Plaza Planned Unit Development (Amend P UD). ALTE R N AT IV E R E C O MME N D ATIO N(S): None. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None AGENDA SECTION:PROPOSED ORDINANCES AGENDA ITEM #4. STAFF RE P ORT NO. 30 CIT Y COUNCIL ME E T ING 2/11/2020 RE P O RT P RE PA RE D B Y: Melissa P oehlman, A sst. C ommunity D evelopment D irector D E PA RTME NT D IRE C TO R RE V IE W: John S tark, C ommunity D evelopment D irector 2/4/2020 O THE R D E PA RTM E NT RE V IE W: Jennifer A nderson, S upport S ervices S upervisor C ITY MA NA G E R RE V IE W: K atie Rodriguez 2/5/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider approval of an ordinance, and summary publication of said ordinance, amending Section 405 of the City Code related to housing maintenance and adopting the International Property Maintenance Code (IP MC). E X E C UT IV E S UM M ARY: I n order to protect public health, safety, and welfare, the City has established a number of housing maintenance standards. These regulations are generally found in Section 405 of the City Code and have been in place, in some form, since the early 1980s. I n 1998, the I nternational Code Council published its first I nternational Property Maintenance Code (I P MC). The I P MC establishes minimum requirements for the maintenance of existing buildings through model code regulations that contain clear and specific property maintenance and improvement provisions. Two states (New York and Virginia) and over 600 jurisdictions have adopted the I P MC with individual modifications, including at least 22 cities in Minnesota. The I P MC is updated on a 3-year cycle. The City's Housing I nspectors have long-desired the adoption of the I P MC, which provides clearer and more specific language than the City's current Housing Code. Adoption of the I P MC by reference, with the proposed minor amendments, will not change property maintenance requirements within the City, but rather will allow Housing I nspectors to cite specific and clear code language to property owners/managers and thereby provide better guidance and customer service. RE C O M M E ND E D AC T I O N: By motion: 1. Approve the attached ordinance amending Section 405 (Housing Code) of the City Code and adopting, by reference and as amended, the International Property Maintenance Code (IP MC); and 2. Approve a resolution authorizing summary publication of the attached ordinance amending Section 405 (Housing Code) of the City Code and adopting, by reference and as amended, the International Property Maintenance Code (IP MC). B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T See Executive Summary B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): A first reading of the proposed ordinance was approved by the City Council on J anuary 28, 2020. Summary publication of adopted ordinances is permitted when the verbatim text of the amendment is cumbersome, and the expense of publication of the complete text is not justified. C.C R IT IC AL T IMIN G IS S U E S: None D.F IN AN C IAL IMPAC T: None E.L E GAL C ON S ID E R AT ION: The City Attorney has reviewed the proposed ordinance. ALTE R N AT IV E R E C O MME N D ATIO N(S): Reject the adoption of the I nternational Property Maintenance Code; existing Codes shall remain in place. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None AT TAC H ME N T S: D escription Type Ordinance Ordinance Resolution Resolution L etter A mended IP MC E xhibit BILL NO. _____ AN ORDINANCE REPEALING SECTION 405 (HOUSING CODE) OF THE CITY CODE OF ORDINANCES AND ADOPTING THE INTERNATIONAL PROPERTY MAINTENANCE CODE WITH AMENDMENTS THE CITY OF RICHFIELD DOES ORDAIN: Section 1. Subsection 405 of the Richfield City Code relating to housing maintenance is hereby repealed and replaced as follows: Subsection 405.00. Purpose and policy. The purpose of this Section, which will be known as the housing maintenance code, is to protect the public health, safety, and welfare. This Section: a) Sets minimum standards for basic equipment and facilities, light, ventilation and heating, and minimum space, use, and location requirements; b) Determines the responsibilities of owners, operators, and residents of dwellings; and c) Provides for enforcement and penalties. 405.03. Adoption of International Property Maintenance Code. Subdivision 1. Adoption of IPMC. The International Property Maintenance Code (IPMC), 2018 Edition, published by the International Code Council, Inc., is adopted by reference, subject to the amendments set forth in Subdivision 2, below. Subd. 2. Amendments to IPMC. The IPMC is amended as follows: 101.1 Title. These regulations shall be known as the International Property Maintenance Code of the City of Richfield, hereinafter referred to as “this code.” 102.3 Application of other codes. Repairs, additions or alterations to a structure, or changes of occupancy, shall be done in accordance with the procedures and provisions of the International Building Code, International Existing Building Code, International Energy Conservation Code, International Fire Code, International Fuel Gas Code, International Mechanical Code, International Residential Code, International Plumbing Code and NFPA 70 the Minnesota State Building Code (MSBC), established pursuant to M.S. §§ 326B.101 to 326B.194, as adopted by the City. Nothing in this code shall be construed to cancel, modify or set aside any provision of the International Zoning Code City of Richfield Zoning Code. 102.3.1 Minnesota State Building Code substitution. Throughout this Code, all references to the “International Building Code” shall be struck and replaced with “Minnesota State Building Code.” 102.7 Referenced codes and standards. The codes and standards referenced in this code shall be those that are listed in Chapter 8 and considered part of the requirements of this code to the prescribed extent of each such reference and as further regulated in Sections 102.7.1 and 102.7.2. Where differences occur between provisions of this code and the MSBC, the MSBC shall apply. Exception: Where enforcement of a code provision would violate the conditions of the listing of the equipment or appliance, the conditions of the listing shall apply. [A] 102.7.1 Conflicts. Where conflicts occur between provisions of this code and the referenced standards, the provisions of this code shall apply. [A] 102.7.2 Provisions in referenced codes and standards. Where the extent of the reference to a referenced code or standard includes subject matter that is within the scope of this code, the provisions of this code, as applicable, shall take precedence over the provisions in the referenced code or standard. 103.1 General. The department of property maintenance inspection is hereby created and the executive official in charge thereof shall be known as the code official. The City Manager or his or her designee is responsible for administering the provisions of this code. Collectively, these designees shall be known as the Code Official. 103.5 Fees. The fees for activities and services performed by the department in carrying out its responsibilities under this code shall be as indicated in the following fee schedule: Appendix D of the Richfield City Code. 106.4 Violation penalties. Any person who shall violate a provision of this code, or fail to comply therewith, or with any of the requirements thereof, shall be prosecuted within the limits provided by state or local laws. Each day that a violation continues after due notice has been served shallmay be deemed a separate offense. 107.1 Notice to person responsible. Whenever the code official determines that there has been a violation of this code or has grounds to believe that a violation has occurred, notice shall be given in the manner prescribed in Sections 107.2 and 107.3 to the person responsible for the violations as specified in this code. Notices for condemnation procedures shall comply with Section 108.3. 107.2 Form. Such notice prescribed in Section 107.1 shall be in accordance with all of the following: 1. Be in writing. 2. Include a description of the real estate sufficient for identification. 3. Include a statement of the violation or violations and why the notice is being issued. 4. Include a correction order allowing a reasonable time to make the repairs and improvements required to bring the dwelling unit or structure into compliance with the provisions of this code. 5. Inform the property owner or owner’s authorized agent of the right to appeal. 6. Include a statement of the right to file a lien in accordance with Section 106.3. Section 108 Unsafe Structures and Equipment is deleted in its entirety. 111.1 Application for appeal. Any person directly affected by a decision of the code official or a notice or order listed under this code shall have the right to appeal to the board of appeals, provided that a written application under Section 320 of the city code. An application for appeal shall be based on a claim that the true intent of this code or the rules legally adopted thereunder have been incorrectly interpreted, the provisions of this code do not fully apply, or the requirements of this code are adequately satisfied by other means. 111.2 Membership of board is deleted in its entirety. 111.3 Notice of meeting is deleted in its entirety. 111.4 Open hearing is deleted in its entirety. 111.5 Postponed hearing is deleted in its entirety. 111.6 Board decision is deleted in its entirety. 111.7 Court review is deleted in its entirety. 111.8 Stays of enforcement is deleted in its entirety. Section 112 Stop Work Order is deleted in its entirety. 201.3 Terms defined in other codes. Where terms are not defined in this code and are defined in the International Building Code, International Existing Building Code, International Fire Code, International Fuel Gas Code, International Mechanical Code, International Plumbing Code, International Residential Code, International Zoning Code or NFPA 70 MSBC and the city code, such terms shall have the meanings ascribed to them in those codes. Section 202 General Definitions shall be amended as follows: Garbage. The animal or vegetable waste resulting from the handling, preparation, cooking and consumption of food. (Also see “Rubbish.” Garbage and Rubbish shall be taken to encompass both definitions herein.) Rubbish. Combustible and noncombustible waste materials, except garbage; the term shall include the residue from the burning of wood, coal, coke and other combustible materials, paper, rags, cartons, boxes, wood, excelsior, rubber, leather, tree branches, yard trimmings, tin cans, metals, mineral matter, glass, crockery and dust and other similar materials. (Also see “Garbage.” Rubbish and Garbage shall be taken to encompass both definitions herein.) 301.3 Vacant structures and land. Vacant structures and premises thereof or vacant land shall be maintained in a clean, safe, secure and sanitary condition as provided herein so as not to cause a blighting problem or adversely affect the public health or safety in Section 925.02 of the city code. 302.4 Weeds is deleted in its entirety. 302.5 Rodent harborage is deleted in its entirety. 302.9 Defacement of property. A person shall not willfully or wantonly damage, mutilate or deface any exterior surface of any structure or building on any private or public property by placing thereon any marking, carving or graffiti. It shall be the responsibility of the owner to restore said surface to an approved state of maintenance and repair within 48 hours or as designated by the code official. 304.2 Protective treatment. Exterior surfaces, including but not limited to, doors, door and window frames, cornices, porches, trim, balconies, decks and fences, shall be maintained in good condition. Exterior wood surfaces, other than decay-resistant woods, shall be protected from the elements and decay by painting or other protective covering or treatment. Peeling, flaking and chipped paint shall be eliminated and surfaces repainted if on more than 20% of one side of any surface or building. Siding and masonry joints, as well as those between the building envelope and the perimeter of windows, doors and skylights, shall be maintained weather resistant and water tight. Metal surfaces subject to rust or corrosion shall be coated to inhibit such rust and corrosion, and surfaces with rust or corrosion shall be stabilized and coated to inhibit future rust and corrosion. Oxidation stains shall be removed from exterior surfaces. Surfaces designed for stabilization by oxidation are exempt from this requirement. 304.14 Insect screens. During the period from [date] to [date], every Every door, window and other outside opening required for ventilation of habitable rooms, food preparation areas, food service areas or any areas where products to be included or utilized in food for human consumption are processed, manufactured, packaged or stored shall be supplied with approved tightly fitting screens of minimum 16 mesh per inch (16 mesh per 25mm), and every screen door used for insect control shall have a self-closing device in good working condition. Subsections 308.1 – 308.3 related to rubbish and garbage are replaced in their entirety as follows: 308.1 Disposal of garbage or rubbish. The City of Richfield reserves the right to utilize the enforcement and notice processes in Section 601 of the Richfield City Code for garbage, yard waste, and recyclables preparation, collection, and disposal, scavenging, and air pollution. 602.3 Heat supply. Every owner and operator of any building who rents, leases or lets one or more dwelling units or sleeping units on terms, either expressed or implied, to furnish heat to the occupants thereof shall supply heat during the period from September 15 to May 15 to maintain a minimum temperature of 68°F (20°C) in all habitable rooms, bathrooms and toilet rooms. Exceptions: 1. When the outdoor temperature is below the winter outdoor design temperature for the locality, maintenance of the minimum room temperature shall not be required provided that the heating system is operating at its full design capacity. The winter outdoor design temperature for the locality shall be as indicated in Appendix D of the International Plumbing Code. 2. In areas where the average monthly temperature is above 30°F (-1°C), a minimum temperature of 65°F (18°C) shall be maintained. 602.4 Occupiable work spaces. Indoor occupiable work spaces shall be supplied with heat during the period from September 15 to May 15 to maintain a minimum temperature of 65°F (18°C) during the period the spaces are occupied. Exceptions: 1. Processing, storage and operation areas that require cooling or special temperature conditions. 2. Area in which persons are primarily engaged in vigorous physical activities. 703.7 Vertical shafts is deleted in its entirety. Sec. 2. This Ordinance will be effective in accordance with Section 3.09 of the City Charter. Passed by the City Council of the City of Richfield, Minnesota this 11th day of February, 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk RESOLUTION NO. _____ RESOLUTION APPROVING SUMMARY PUBLICATION OF AN ORDINANCE REPEALING SECTION 405 (HOUSING CODE) OF THE CITY CODE OF ORDINANCES AND ADOPTING THE INTERNATIONAL PROPERTY MAINTENANCE CODE WITH AMENDMENTS WHEREAS, the City has adopted the above referenced amendment of the Richfield City Code; and WHEREAS, the verbatim text of the amendment is cumbersome, and the expense of publication of the complete text is not justified. NOW THEREFORE, BE IT RESOLVED by the City Council of the City of Richfield that the following summary is hereby approved for official publication: SUMMARY PUBLICATION BILL NO. ________ AN ORDINANCE REPEALING SECTION 405 (HOUSING CODE) OF THE CITY CODE OF ORDINANCES AND ADOPTING THE INTERNATIONAL PROPERTY MAINTENANCE CODE WITH AMENDMENTS This summary of the ordinance is published pursuant to Section 3.12 of the Richfield City Charter. This ordinance revises rules related the administration of Housing Maintenance. The City will now enforce housing maintenance regulations as described in the International Property Maintenance Code (IPMC). The IPMC establishes minimum requirements for the maintenance of existing buildings through model code regulations that contain clear and specific property maintenance and improvement rules. Adoption of the IPMC, as amended, will not significantly change any property maintenance requirements within the City, but rather will provide additional clarity and detailed information to property owners and managers. Copies of the ordinance are available for public inspection in the City Clerk’s office during normal business hours or upon request by calling the Department of Community Development at (612) 861-9760. Adopted by the City Council of the City of Richfield, Minnesota this 11th day of February, 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk 100727338 222 020 1 8 INTERNATIO NAL CODES ® Get a free 45-day online subscription to ICC’s premiumACCESS™ 2018 I-Codes Complete Collection. Test drive many powerful, time-saving tools available to you from premiumACCESS. To activate your bonus, visit www.iccsafe.org/codebonus. 2018 I-CODE BONUS OFFER INTERNATIONAL PROPERTY MAINTENANCE CODE® IPMC ® A Member of the International Code Family® Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,QWHUQDWLRQDO3URSHUW\0DLQWHQDQFH&RGH® )LUVW3ULQWLQJ$XJXVW ,6%1VRIWFRYHUHGLWLRQ &23<5,*+7¤ E\ ,17(51$7,21$/&2'(&281&,/,1& 'DWHRI)LUVW3XEOLFDWLRQ$XJXVW $//5,*+765(6(59('7KLV,QWHUQDWLRQDO3URSHUW\0DLQWHQDQFH&RGH®LVDFRS\ULJKWHGZRUNRZQHGE\WKH,QWHUQD WLRQDO&RGH&RXQFLO,QF:LWKRXWDGYDQFHZULWWHQSHUPLVVLRQIURPWKHFRS\ULJKWRZQHUQRSDUWRIWKLVERRNPD\EHUHSUR GXFHGGLVWULEXWHGRUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQVLQFOXGLQJZLWKRXWOLPLWDWLRQHOHFWURQLFRSWLFDORUPHFKDQLFDO PHDQVE\ZD\RIH[DPSOHDQGQRWOLPLWDWLRQSKRWRFRS\LQJRUUHFRUGLQJE\RULQDQLQIRUPDWLRQVWRUDJHUHWULHYDOV\VWHP)RU LQIRUPDWLRQRQXVHULJKWVDQGSHUPLVVLRQVSOHDVHFRQWDFW3XEOLFDWLRQV)ORVVPRRU5RDG&RXQWU\&OXE+LOOV,/ 3KRQH,&&6$)( 7UDGHPDUNV³,QWHUQDWLRQDO&RGH&RXQFLO´WKH³,QWHUQDWLRQDO&RGH&RXQFLO´ORJR³,&&´WKH³,&&´ORJR³,QWHUQDWLRQDO3URS HUW\0DLQWHQDQFH&RGH´³,30&´DQGRWKHUQDPHVDQGWUDGHPDUNVDSSHDULQJLQWKLVERRNDUHWUDGHPDUNVRIWKH,QWHUQDWLRQDO &RGH&RXQFLO,QFDQGRULWVOLFHQVRUVDVDSSOLFDEOHDQGPD\QRWEHXVHGZLWKRXWSHUPLVVLRQ 35,17(',17+(86$ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'(LLL PREFACE Introduction The International Property Maintenance Code£ (IPMC£) establishes minimum requirements for the maintenance of existing buildings through model code regulations that contain clear and spe- cific property maintenance and property improvement provisions. This 2018 edition is fully com- patible with all of the International Codes£ (I-Codes£) published by the International Code Council£ (ICC£), including the International Building Code£, International Energy Conservation Code£, International Existing Building Code£, International Fire Code£, International Fuel Gas Code£, International Green Construction Code£, International Mechanical Code£, International Plumbing Code£, International Private Sewage Disposal Code£, International Residential Code£, International Swimming Pool and Spa Code£, International Wildland-Urban Interface Code£, Inter- national Zoning Code£ and International Code Council Performance Code£. The I-Codes, including this International Property Maintenance Code, are used in a variety of ways in both the public and private sectors. Most industry professionals are familiar with the I-Codes as the basis of laws and regulations in communities across the U.S. and in other countries. However, the impact of the codes extends well beyond the regulatory arena, as they are used in a variety of nonregulatory settings, including: • Voluntary compliance programs such as those promoting sustainability, energy efficiency and disaster resistance. • The insurance industry, to estimate and manage risk, and as a tool in underwriting and rate decisions. • Certification and credentialing of individuals involved in the fields of building design, con- struction and safety. • Certification of building and construction-related products. • U.S. federal agencies, to guide construction in an array of government-owned properties. • Facilities management. • “Best practices” benchmarks for designers and builders, including those who are engaged in projects in jurisdictions that do not have a formal regulatory system or a governmental enforcement mechanism. • College, university and professional school textbooks and curricula. • Reference works related to building design and construction. In addition to the codes themselves, the code development process brings together building pro- fessionals on a regular basis. It provides an international forum for discussion and deliberation about building design, construction methods, safety, performance requirements, technological advances and innovative products. Development This 2018 edition presents the code as originally issued, with changes reflected in the 2003 through 2015 editions and further changes developed through the ICC Code Development Process through 2016. A new edition of the code is promulgated every 3 years. This code is intended to establish provisions that adequately protect public health, safety and welfare; that do not unnecessarily increase construction costs; that do not restrict the use of new materials, products or methods of construction; and that do not give preferential treatment to par- ticular types or classes of materials, products or methods of construction. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 LY ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Maintenance The International Property Maintenance Code is kept up to date through the review of proposed changes submitted by code enforcement officials, industry representatives, design professionals and other interested parties. Proposed changes are carefully considered through an open code development process in which all interested and affected parties may participate. The ICC Code Development Process reflects principles of openness, transparency, balance, due process and consensus, the principles embodied in OMB Circular A-119, which governs the federal government’s use of private-sector standards. The ICC process is open to anyone; there is no cost to participate, and people can participate without travel cost through the ICC’s cloud-based app, cdp- Access£. A broad cross section of interests are represented in the ICC Code Development Process. The codes, which are updated regularly, include safeguards that allow for emergency action when required for health and safety reasons. In order to ensure that organizations with a direct and material interest in the codes have a voice in the process, the ICC has developed partnerships with key industry segments that support the ICC’s important public safety mission. Some code development committee members were nomi- nated by the following industry partners and approved by the ICC Board: • American Institute of Architects (AIA) • National Association of Home Builders (NAHB) The code development committees evaluate and make recommendations regarding proposed changes to the codes. Their recommendations are then subject to public comment and council-wide votes. The ICC’s governmental members—public safety officials who have no financial or business interest in the outcome—cast the final votes on proposed changes. The contents of this work are subject to change through the code development cycles and by any governmental entity that enacts the code into law. For more information regarding the code devel- opment process, contact the Codes and Standards Development Department of the International Code Council. While the I-Code development procedure is thorough and comprehensive, the ICC, its members and those participating in the development of the codes disclaim any liability resulting from the publication or use of the I-Codes, or from compliance or noncompliance with their provisions. The ICC does not have the power or authority to police or enforce compliance with the contents of this code. Code Development Committee Responsibilities (Letter Designations in Front of Section Numbers) In each code development cycle, proposed changes to this code are considered at the Committee Action Hearings by the International Property Maintenance Code Development Committee, whose action constitutes a recommendation to the voting membership for final action on the proposed changes. Proposed changes to a code section having a number beginning with a letter in brackets are considered by a different code development committee. For example, proposed changes to code sections that have the letter [F] in front of them (e.g., [F] 704.1) are considered by the Interna- tional Fire Code Development Committee at the Committee Action Hearings. The content of sections in this code that begin with a letter designation is maintained by another code development committee in accordance with the following: [A] = Administrative Code Development Committee; [F] = International Fire Code Development Committee; [P] = International Plumbing Code Development Committee; [BE] = IBC—Egress Code Development Committee; and [BG]= IBC—General Code Development Committee. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'(Y For the development of the 2021 edition of the I-Codes, there will be two groups of code devel- opment committees and they will meet in separate years. Code change proposals submitted for code sections that have a letter designation in front of them will be heard by the respective committee responsible for such code sections. Because differ- ent committees hold Committee Action Hearings in different years, proposals for the IPMC will be heard by committees in both the 2018 (Group A) and the 2019 (Group B) code development cycles. For instance, every section of Chapter 1 of this code is designated as the responsibility of the Administrative Code Development Committee, which is part of the Group B portion of the hearings. This committee will hold its Committee Action Hearings in 2019 to consider code change proposals for Chapter 1 of all I-Codes except the International Energy Conservation Code, International Resi- dential Code and International Green Construction Code. Therefore, any proposals received for Chapter 1 of this code will be assigned to the Administrative Code Development Committee for con- sideration in 2019. It is very important that anyone submitting code change proposals understand which code devel- opment committee is responsible for the section of the code that is the subject of the code change proposal. For further information on the code development committee responsibilities, please visit the ICC website at www.iccsafe.org/scoping. Group A Codes (Heard in 2018, Code Change Proposals Deadline: January 8, 2018) Group B Codes (Heard in 2019, Code Change Proposals Deadline: January 7, 2019) International Building Code – Egress (Chapters 10, 11, Appendix E) – Fire Safety (Chapters 7, 8, 9, 14, 26) – General (Chapters 2–6, 12, 27–33, Appendices A, B, C, D, K, N) Administrative Provisions (Chapter 1 of all codes except IECC, IRC and IgCC, administra- tive updates to currently referenced stan- dards, and designated definitions) International Fire Code International Building Code – Structural (Chapters 15–25, Appendices F, G, H, I, J, L, M) International Fuel Gas Code International Existing Building Code International Mechanical Code International Energy Conservation Code— Commercial International Plumbing Code International Energy Conservation Code— Residential – IECC—Residential – IRC—Energy (Chapter 11) International Property Maintenance Code International Green Construction Code (Chapter 1) International Private Sewage Disposal Code International Residential Code – IRC—Building (Chapters 1–10, Appendices E, F, H, J, K, L, M, O, Q, R, S, T) International Residential Code – IRC—Mechanical (Chapters 12–23) – IRC—Plumbing (Chapters 25–33, Appendices G, I, N, P) International Swimming Pool and Spa Code International Wildland-Urban Interface Code International Zoning Code Note: Proposed changes to the ICC Performance Code¥ will be heard by the code development committee noted in brack- ets [ ] in the text of the ICC Performance Code¥. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 YL ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Marginal Markings Solid vertical lines in the margins within the body of the code indicate a technical change from the requirements of the 2015 edition. Deletion indicators in the form of an arrow ( ) are provided in the margin where an entire section, paragraph, exception or table has been deleted or an item in a list of items or a table has been deleted. Coordination of the International Codes The coordination of technical provisions is one of the strengths of the ICC family of model codes. The codes can be used as a complete set of complementary documents, which will provide users with full integration and coordination of technical provisions. Individual codes can also be used in subsets or as stand-alone documents. To make sure that each individual code is as complete as pos- sible, some technical provisions that are relevant to more than one subject area are duplicated in some of the model codes. This allows users maximum flexibility in their application of the I-Codes. Italicized Terms Words and terms defined in Chapter 2, Definitions, are italicized where they appear in code text and the Chapter 2 definition applies. Where such words and terms are not italicized, common-use defi- nitions apply. The words and terms selected have code-specific definitions that the user should read carefully to facilitate better understanding of the code. Adoption The International Code Council maintains a copyright in all of its codes and standards. Maintaining copyright allows the ICC to fund its mission through sales of books, in both print and electronic for- mats. The ICC welcomes adoption of its codes by jurisdictions that recognize and acknowledge the ICC’s copyright in the code, and further acknowledge the substantial shared value of the public/pri- vate partnership for code development between jurisdictions and the ICC. The ICC also recognizes the need for jurisdictions to make laws available to the public. All I- Codes and I-Standards, along with the laws of many jurisdictions, are available for free in a nondownloadable form on the ICC’s website. Jurisdictions should contact the ICC at adop- tions@iccsafe.org to learn how to adopt and distribute laws based on the International Prop- erty Maintenance Code in a manner that provides necessary access, while maintaining the ICC’s copyright. To facilitate adoption, several sections of this code contain blanks for fill-in information that needs to be supplied by the adopting jurisdiction as part of the adoption legislation. For this code, please see: Section 101.1. Insert: [NAME OF JURISDICTION] Section 103.5. Insert: [APPROPRIATE SCHEDULE] Section 112.4. Insert: [DOLLAR AMOUNT IN TWO LOCATIONS] Section 302.4. Insert: [HEIGHT IN INCHES] Section 304.14. Insert: [DATES IN TWO LOCATIONS] Section 602.3. Insert: [DATES IN TWO LOCATIONS] Section 602.4. Insert: [DATES IN TWO LOCATIONS] Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'(YLL EFFECTIVE USE OF THE INTERNATIONAL PROPERTY MAINTENANCE CODE The International Property Maintenance Code (IPMC) is a model code that regulates the minimum maintenance requirements for existing buildings. The IPMC is a maintenance document intended to establish minimum maintenance standards for basic equipment, light, ventilation, heating, sanitation and fire safety. Responsibility is fixed among owners, operators and occupants for code compliance. The IPMC provides for the regulation and safe use of existing structures in the interest of the social and economic welfare of the community. Arrangement and Format of the 2018 IPMC Before applying the requirements of the IPMC it is beneficial to understand its arrangement and for- mat. The IPMC, like other codes published by ICC, is arranged and organized to follow sequential steps that generally occur during an inspection. The IPMC is divided into eight different parts: The following is a chapter-by-chapter synopsis of the scope and intent of the provisions of the Inter- national Property Maintenance Code: Chapter 1 Scope and Administration. This chapter contains provisions for the application, enforcement and administration of subsequent requirements of the code. In addition to establish- ing the scope of the code, Chapter 1 identifies which buildings and structures come under its pur- view. Chapter 1 is largely concerned with maintaining “due process of law” in enforcing the property maintenance criteria contained in the body of the code. Only through careful observation of the administrative provisions can the building official reasonably expect to demonstrate that “equal protection under the law” has been provided. Chapter 2 Definitions. All terms that are defined in the code are listed alphabetically in Chapter 2. While a defined term may be used in one chapter or another, the meaning provided in Chapter 2 is applicable throughout the code. Where understanding of a term’s definition is especially key to or necessary for understanding of a particular code provision, the term is shown in italics. This is true only for those terms that have a meaning that is unique to the code. In other words, the generally understood meaning of a term or phrase might not be sufficient or consistent with the meaning prescribed by the code; therefore, it is essential that the code-defined meaning be known. Guidance is provided regarding tense, gender and plurality of defined terms as well as terms not defined in this code. Chapters Subjects 1 Scope and Administration 2 Definitions 3 General Requirements 4 Light, Ventilation and Occupancy Limitations 5 Plumbing Facilities and Fixture Requirements 6 Mechanical and Electrical Requirements 7 Fire Safety Requirements 8 Referenced Standards Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 YLLL ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Chapter 3 General Requirements. Chapter 3, “General Requirements,” is broad in scope. It includes a variety of requirements for the exterior property areas as well as the interior and exterior elements of the structure. This chapter provides requirements that are intended to maintain a min- imum level of safety and sanitation for both the general public and the occupants of a structure, and to maintain a building’s structural and weather-resistance performance. Chapter 3 provides specific criteria for regulating the installation and maintenance of specific building components; mainte- nance requirements for vacant structures and land; requirements regulating the safety, sanitation and appearance of the interior and exterior of structures and all exterior property areas; accessory structures; vehicle storage regulations and establishes who is responsible for complying with the chapter’s provisions. This chapter also contains the requirements for swimming pools, spas and hot tubs and the requirements for protective barriers and gates in these barriers. Chapter 3 establishes the responsible parties for exterminating insects and rodents, and maintaining sanitary conditions in all types of occupancies. Chapter 4 Light, Ventilation and Occupancy Limitations. The purposes of Chapter 4 are to set forth these requirements in the code and to establish the minimum environment for occupiable and habitable buildings, by establishing the minimum criteria for light and ventilation and identify- ing occupancy limitations including minimum room width and area, minimum ceiling height and restrictions to prevent overcrowding. This chapter also provides for alternative arrangements of windows and other devices to comply with the requirements for light and ventilation and prohibits certain room arrangements and occupancy uses. Chapter 5 Plumbing Facilities and Fixture Requirements. Chapter 5 establishes the mini- mum criteria for the installation, maintenance and location of plumbing systems and facilities, including the water supply system, water heating appliances, sewage disposal system and related plumbing fixtures. Sanitary and clean conditions in occupied buildings are dependent upon certain basic plumbing principles, including providing potable water to a building, providing the basic fixtures to effectively utilize that water and properly removing waste from the building. Chapter 5 establishes the mini- mum criteria to verify that these principles are maintained throughout the life of a building. Chapter 6 Mechanical and Electrical Requirements. The purpose of Chapter 6 is to establish minimum performance requirements for heating, electrical and mechanical facilities and to estab- lish minimum standards for the safety of these facilities. This chapter establishes minimum criteria for the installation and maintenance of the following: heating and air-conditioning equipment, appliances and their supporting systems; water heating equipment, appliances and systems; cooking equipment and appliances; ventilation and exhaust equipment; gas and liquid fuel distribution piping and components; fireplaces and solid fuel-burning appliances; chimneys and vents; electrical services; lighting fixtures; electrical receptacle outlets; electrical distribution system equipment, devices and wiring; and elevators, escalators and dumb- waiters. Chapter 7 Fire Safety Requirements. The purpose of Chapter 7 is to address those fire hazards that arise as the result of a building’s occupancy. It also provides minimum requirements for fire safety issues that are most likely to arise in older buildings. This chapter contains requirements for means of egress in existing buildings, including path of travel, required egress width, means of egress doors and emergency escape openings. Chapter 7 establishes the minimum requirements for fire safety facilities and fire protection sys- tems, as these are essential fire safety systems. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'(L[ Chapter 8 Referenced Standards. The code contains numerous references to standards that are used to regulate materials and methods of construction. Chapter 8 contains a comprehensive list of all standards that are referenced in the code. The standards are part of the code to the extent of the reference to the standard. Compliance with the referenced standard is necessary for compli- ance with this code. By providing specifically adopted standards, the construction and installation requirements necessary for compliance with the code can be readily determined. The basis for code compliance is, therefore, established and available on an equal basis to the code official, contractor, designer and owner. Chapter 8 is organized in a manner that makes it easy to locate specific standards. It lists all of the referenced standards, alphabetically, by acronym of the promulgating agency of the standard. Each agency’s standards are then listed in either alphabetical or numeric order based upon the stan- dard identification. The list also contains the title of the standard; the edition (date) of the standard referenced; any addenda included as part of the ICC adoption; and the section or sections of this code that reference the standard. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 [,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'([L TABLE OF CONTENTS &+$37(5 6&23($1'$'0,1,675$7,21 3$57²6&23($1'$33/,&$7,21 6HFWLRQ *HQHUDO $SSOLFDELOLW\ 3$57²$'0,1,675$7,21$1' (1)25&(0(17 6HFWLRQ 'HSDUWPHQWRI3URSHUW\0DLQWHQDQFH ,QVSHFWLRQ 'XWLHVDQG3RZHUVRIWKH&RGH2IILFLDO $SSURYDO 9LRODWLRQV 1RWLFHVDQG2UGHUV 8QVDIH6WUXFWXUHVDQG(TXLSPHQW (PHUJHQF\0HDVXUHV 'HPROLWLRQ 0HDQVRI$SSHDO 6WRS:RUN2UGHU &+$37(5 '(),1,7,216 6HFWLRQ *HQHUDO *HQHUDO'HILQLWLRQV &+$37(5 *(1(5$/5(48,5(0(176 6HFWLRQ *HQHUDO ([WHULRU3URSHUW\$UHDV 6ZLPPLQJ3RROV6SDVDQG+RW7XEV ([WHULRU6WUXFWXUH ,QWHULRU6WUXFWXUH &RPSRQHQW6HUYLFHDELOLW\ +DQGUDLOVDQG*XDUGUDLOV 5XEELVKDQG*DUEDJH 3HVW(OLPLQDWLRQ &+$37(5 /,*+79(17,/$7,21$1' 2&&83$1&</,0,7$7,216 6HFWLRQ *HQHUDO /LJKW 9HQWLODWLRQ 2FFXSDQF\/LPLWDWLRQV &+$37(5 3/80%,1*)$&,/,7,(6$1' ),;785(5(48,5(0(176 6HFWLRQ *HQHUDO 5HTXLUHG)DFLOLWLHV 7RLOHW5RRPV 3OXPELQJ6\VWHPVDQG)L[WXUHV :DWHU6\VWHP 6DQLWDU\'UDLQDJH6\VWHP 6WRUP'UDLQDJH &+$37(5 0(&+$1,&$/$1'(/(&75,&$/ 5(48,5(0(176 6HFWLRQ *HQHUDO +HDWLQJ)DFLOLWLHV 0HFKDQLFDO(TXLSPHQW (OHFWULFDO)DFLOLWLHV (OHFWULFDO(TXLSPHQW (OHYDWRUV(VFDODWRUVDQG'XPEZDLWHUV 'XFW6\VWHPV &+$37(5 ),5(6$)(7<5(48,5(0(176 6HFWLRQ *HQHUDO 0HDQVRI(JUHVV )LUHUHVLVWDQFH5DWLQJV )LUH3URWHFWLRQ6\VWHPV &DUERQ0RQR[LGH$ODUPVDQG'HWHFWLRQ &+$37(5 5()(5(1&('67$1'$5'6 $33(1',;$ %2$5',1*67$1'$5' 6HFWLRQ $ *HQHUDO $ 0DWHULDOV $ ,QVWDOODWLRQ $ 5HIHUHQFHG6WDQGDUG ,1'(; Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 [LL ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 6&23($1'$'0,1,675$7,21 User note: About this chapter:Chapter 1 establishes the limits of applicability of the code and describes how the code is to be applied and enforced. Chapter 1 is in two parts: Part 1—Scope and Application (Sections 101 and 102) and Part 2—Administration and Enforcement (Sections 103 – 112). Section 101 identifies which buildings and structures come under its purview and references other I-Codes as applicable. This code is intended to be adopted as a legally enforceable document and it cannot be effective without adequate provisions for its adminis- tration and enforcement. The provisions of Chapter 1 establish the authority and duties of the code official appointed by the authority having jurisdiction and also establish the rights and privileges of the property owner and building occupants. 3$57²6&23($1'$33/,&$7,21 6(&7,21 *(1(5$/ >$@ 7LWOH 7KHVH UHJXODWLRQV VKDOO EH NQRZQ DV WKH ,QWHUQDWLRQDO 3URSHUW\ 0DLQWHQDQFH &RGHRI>1$0( 2) -85,6',&7,21@KHUHLQDIWHUUHIHUUHGWRDV³WKLVFRGH´ >$@6FRSH7KHSURYLVLRQVRIWKLVFRGHVKDOODSSO\WR DOOH[LVWLQJUHVLGHQWLDODQGQRQUHVLGHQWLDOVWUXFWXUHVDQGDOO H[LVWLQJSUHPLVHVDQGFRQVWLWXWHPLQLPXPUHTXLUHPHQWVDQG VWDQGDUGVIRUSUHPLVHVVWUXFWXUHVHTXLSPHQWDQGIDFLOLWLHV IRU OLJKWYHQWLODWLRQ VSDFH KHDWLQJ VDQLWDWLRQ SURWHFWLRQ IURPWKHHOHPHQWVDUHDVRQDEOHOHYHORIVDIHW\IURPILUHDQG RWKHUKD]DUGVDQGIRUDUHDVRQDEOHOHYHORIVDQLWDU\PDLQWH QDQFHWKHUHVSRQVLELOLW\RIRZQHUVDQRZQHU¶VDXWKRUL]HG DJHQWRSHUDWRUVDQGRFFXSDQWVWKHRFFXSDQF\RIH[LVWLQJ VWUXFWXUHVDQGSUHPLVHVDQGIRUDGPLQLVWUDWLRQHQIRUFHPHQW DQGSHQDOWLHV >$@,QWHQW7KLVFRGHVKDOOEHFRQVWUXHGWRVHFXUHLWV H[SUHVVHGLQWHQWZKLFKLVWRHQVXUHSXEOLFKHDOWKVDIHW\DQG ZHOIDUHLQVRIDUDVWKH\DUHDIIHFWHGE\WKHFRQWLQXHGRFFX SDQF\DQGPDLQWHQDQFHRIVWUXFWXUHVDQGSUHPLVHV([LVWLQJ VWUXFWXUHVDQGSUHPLVHVWKDWGRQRWFRPSO\ZLWKWKHVHSURYL VLRQVVKDOOEHDOWHUHGRUUHSDLUHGWRSURYLGHDPLQLPXPOHYHO RIKHDOWKDQGVDIHW\DVUHTXLUHGKHUHLQ >$@ 6HYHUDELOLW\ ,I D VHFWLRQ VXEVHFWLRQ VHQWHQFH FODXVHRUSKUDVHRIWKLVFRGHLVIRUDQ\UHDVRQKHOGWREH XQFRQVWLWXWLRQDOVXFKGHFLVLRQVKDOOQRWDIIHFWWKHYDOLGLW\RI WKHUHPDLQLQJSRUWLRQVRIWKLVFRGH 6(&7,21 $33/,&$%,/,7< >$@*HQHUDO:KHUHWKHUHLVDFRQIOLFWEHWZHHQDJHQ HUDO UHTXLUHPHQW DQG D VSHFLILF UHTXLUHPHQW WKH VSHFLILF UHTXLUHPHQWVKDOOJRYHUQ:KHUHGLIIHUHQFHVRFFXUEHWZHHQ SURYLVLRQVRIWKLVFRGHDQGWKHUHIHUHQFHGVWDQGDUGVWKHSUR YLVLRQVRIWKLVFRGHVKDOODSSO\:KHUHLQDVSHFLILFFDVHGLI IHUHQWVHFWLRQVRIWKLVFRGHVSHFLI\GLIIHUHQWUHTXLUHPHQWVWKH PRVWUHVWULFWLYHVKDOOJRYHUQ 0DLQWHQDQFH(TXLSPHQWV\VWHPVGHYLFHVDQGVDIH JXDUGVUHTXLUHGE\WKLVFRGHRUDSUHYLRXVUHJXODWLRQRUFRGH XQGHUZKLFKWKHVWUXFWXUHRUSUHPLVHVZDVFRQVWUXFWHG DOWHUHGRUUHSDLUHGVKDOOEHPDLQWDLQHGLQJRRGZRUNLQJRUGHU $QRZQHURZQHU¶VDXWKRUL]HGDJHQWRSHUDWRURURFFXSDQW VKDOOQRWFDXVHDQ\VHUYLFHIDFLOLW\HTXLSPHQWRUXWLOLW\WKDW LVUHTXLUHGXQGHUWKLVVHFWLRQWREHUHPRYHGIURPVKXWRII IURPRUGLVFRQWLQXHGIRUDQ\RFFXSLHGGZHOOLQJH[FHSWIRU VXFK WHPSRUDU\ LQWHUUXSWLRQ DV QHFHVVDU\ ZKLOH UHSDLUV RU DOWHUDWLRQVDUHLQSURJUHVV7KHUHTXLUHPHQWVRIWKLVFRGHDUH QRWLQWHQGHGWRSURYLGHWKHEDVLVIRUUHPRYDORUDEURJDWLRQRI ILUH SURWHFWLRQ DQG VDIHW\ V\VWHPV DQG GHYLFHV LQ H[LVWLQJ VWUXFWXUHV([FHSWDVRWKHUZLVHVSHFLILHGKHUHLQWKHRZQHURU WKHRZQHU¶V DXWKRUL]HG DJHQW VKDOO EH UHVSRQVLEOH IRU WKH PDLQWHQDQFHRIEXLOGLQJVVWUXFWXUHVDQGSUHPLVHV >$@$SSOLFDWLRQRIRWKHUFRGHV5HSDLUVDGGLWLRQVRU DOWHUDWLRQVWRDVWUXFWXUHRUFKDQJHVRIRFFXSDQF\VKDOOEH GRQHLQDFFRUGDQFHZLWKWKHSURFHGXUHVDQGSURYLVLRQVRIWKH ,QWHUQDWLRQDO%XLOGLQJ&RGH,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ &RGH ,QWHUQDWLRQDO (QHUJ\ &RQVHUYDWLRQ &RGH ,QWHUQD WLRQDO)LUH&RGH,QWHUQDWLRQDO)XHO*DV&RGH,QWHUQDWLRQDO 0HFKDQLFDO&RGH,QWHUQDWLRQDO5HVLGHQWLDO&RGH,QWHUQD WLRQDO3OXPELQJ&RGHDQG1)3$1RWKLQJLQWKLVFRGH VKDOOEHFRQVWUXHGWRFDQFHOPRGLI\RUVHWDVLGHDQ\SURYL VLRQRIWKH,QWHUQDWLRQDO=RQLQJ&RGH >$@([LVWLQJUHPHGLHV7KHSURYLVLRQVLQWKLVFRGH VKDOOQRWEHFRQVWUXHGWRDEROLVKRULPSDLUH[LVWLQJUHPHGLHV RIWKHMXULVGLFWLRQRULWVRIILFHUVRUDJHQFLHVUHODWLQJWRWKH UHPRYDO RU GHPROLWLRQ RI DQ\ VWUXFWXUH WKDW LV GDQJHURXV XQVDIHDQGLQVDQLWDU\ >$@:RUNPDQVKLS5HSDLUVPDLQWHQDQFHZRUNDOWHU DWLRQVRULQVWDOODWLRQVWKDWDUHFDXVHGGLUHFWO\RULQGLUHFWO\E\ WKHHQIRUFHPHQWRIWKLVFRGHVKDOOEHH[HFXWHGDQGLQVWDOOHG LQDZRUNPDQOLNHPDQQHUDQGLQVWDOOHGLQDFFRUGDQFHZLWKWKH PDQXIDFWXUHU¶VLQVWUXFWLRQV >$@+LVWRULFEXLOGLQJV7KHSURYLVLRQVRIWKLVFRGH VKDOOQRWEHPDQGDWRU\IRUH[LVWLQJEXLOGLQJVRUVWUXFWXUHV GHVLJQDWHG DV KLVWRULF EXLOGLQJV ZKHUH VXFK EXLOGLQJV RU VWUXFWXUHVDUHMXGJHGE\WKHFRGHRIILFLDOWREHVDIHDQGLQWKH SXEOLFLQWHUHVWRIKHDOWKVDIHW\DQGZHOIDUH >$@5HIHUHQFHGFRGHVDQGVWDQGDUGV7KHFRGHVDQG VWDQGDUGVUHIHUHQFHGLQWKLVFRGHVKDOOEHWKRVHWKDWDUHOLVWHG LQ&KDSWHUDQGFRQVLGHUHGSDUWRIWKHUHTXLUHPHQWVRIWKLV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 >$@ 7LWOH 7KHVH UHJXODWLRQV VKDOO EH NQRZQ DV WKH ,QWHUQDWLRQDO 3URSHUW\ 0DLQWHQDQFH &RGH RI >1$0( 2) -85,6',&7,21@ KHUHLQDIWHU UHIHUUHG WR DV WKLV FRGH >$@ 5HIHUHQFHG FRGHV DQG VWDQGDUGV 7KH FRGHV DQG VWDQGDUGV UHIHUHQFHG LQ WKLV FRGH VKDOO EH WKRVH WKDW DUH OLVWHG LQ &KDSWHU DQG FRQVLGHUHG SDUW RI WKH UHTXLUHPHQWV RI WKLVW 1 2 3 Summary of Comments on 2018_IPMC-1st ptg.book Page: 14 Number: 1 Author: MPoehlman Subject: Replace Date: 7/18/2019 2:49:34 PM -05'00' [A] 101.1 Title. These regulations shall be known as the Property Maintenance Code of the City of Richfield, hereinafter referred to as "this code." Number: 2 Author: MPoehlman Subject: Inserted Text Date: 1/16/2020 2:49:31 PM 102.3 Application of other codes. Repairs, additions or alterations to a structure, or changes of occupancy, shall be done in accordance with the procedures and provisions of the Minnesota State Building Code (MSBC), established pursuant to M.S. §§ 326B.101 to 326B.194, as adopted by the city. Nothing in this code shall be construed to cancel, modify or set aside any provision of the City of Richfield ZoningCode. Number: 3 Author: MPoehlman Subject: Replace Date: 1/16/2020 3:01:19 PM 102.7 Referenced codes and standards. The codes and standards referenced in Chapter 8 and considered part of the requirements of this code to the prescribed extent of each such reference. Where differences occur between provisions of this code and the MSBC, the MSBC shall apply. 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( FRGHWRWKHSUHVFULEHGH[WHQWRIHDFKVXFKUHIHUHQFHDQGDV IXUWKHUUHJXODWHGLQ6HFWLRQVDQG ([FHSWLRQ:KHUHHQIRUFHPHQWRIDFRGHSURYLVLRQZRXOG YLRODWHWKHFRQGLWLRQVRIWKHOLVWLQJRIWKHHTXLSPHQWRU DSSOLDQFHWKHFRQGLWLRQVRIWKHOLVWLQJVKDOODSSO\ >$@&RQIOLFWV:KHUHFRQIOLFWVRFFXUEHWZHHQSUR YLVLRQVRIWKLVFRGHDQGWKHUHIHUHQFHGVWDQGDUGVWKHSUR YLVLRQVRIWKLVFRGHVKDOODSSO\ >$@3URYLVLRQVLQ UHIHUHQFHGFRGHVDQG VWDQ GDUGV:KHUHWKHH[WHQWRIWKHUHIHUHQFHWRDUHIHUHQFHG FRGHRUVWDQGDUGLQFOXGHVVXEMHFWPDWWHUWKDWLVZLWKLQWKH VFRSHRIWKLVFRGHWKHSURYLVLRQVRIWKLVFRGHDVDSSOLFD EOHVKDOOWDNHSUHFHGHQFHRYHUWKHSURYLVLRQVLQWKHUHIHU HQFHGFRGHRUVWDQGDUG >$@ 5HTXLUHPHQWV QRW FRYHUHG E\ FRGH 5HTXLUH PHQWVQHFHVVDU\IRUWKHVWUHQJWKVWDELOLW\RUSURSHURSHUDWLRQ RIDQH[LVWLQJIL[WXUHVWUXFWXUHRUHTXLSPHQWRUIRUWKHSXE OLFVDIHW\KHDOWKDQGJHQHUDOZHOIDUHQRWVSHFLILFDOO\FRYHUHG E\WKLVFRGHVKDOOEHGHWHUPLQHGE\WKHFRGHRIILFLDO >$@$SSOLFDWLRQRIUHIHUHQFHV5HIHUHQFHVWRFKDSWHU RUVHFWLRQQXPEHUVRUWRSURYLVLRQVQRWVSHFLILFDOO\LGHQWL ILHGE\QXPEHUVKDOOEHFRQVWUXHGWRUHIHUWRVXFKFKDSWHU VHFWLRQRUSURYLVLRQRIWKLVFRGH >$@2WKHUODZV7KHSURYLVLRQVRIWKLVFRGHVKDOOQRW EHGHHPHGWRQXOOLI\DQ\SURYLVLRQVRIORFDOVWDWHRUIHGHUDO ODZ 3$57²$'0,1,675$7,21$1'(1)25&(0(17 6(&7,21 '(3$570(172)3523(57< 0$,17(1$1&(,163(&7,21 >$@*HQHUDO7KHGHSDUWPHQWRISURSHUW\PDLQWHQDQFH LQVSHFWLRQ LV KHUHE\ FUHDWHG DQG WKH H[HFXWLYH RIILFLDO LQ FKDUJHWKHUHRIVKDOOEHNQRZQDVWKHFRGHRIILFLDO >$@$SSRLQWPHQW7KHFRGHRIILFLDOVKDOOEHDSSRLQWHG E\WKHFKLHIDSSRLQWLQJDXWKRULW\RIWKHMXULVGLFWLRQ >$@'HSXWLHV,QDFFRUGDQFHZLWKWKHSUHVFULEHGSURFH GXUHV RI WKLV MXULVGLFWLRQ DQG ZLWK WKH FRQFXUUHQFH RI WKH DSSRLQWLQJDXWKRULW\WKHFRGHRIILFLDOVKDOOKDYHWKHDXWKRULW\ WRDSSRLQWDGHSXW\V6XFKHPSOR\HHVVKDOOKDYHSRZHUVDV GHOHJDWHGE\WKHFRGHRIILFLDO >$@/LDELOLW\7KHFRGHRIILFLDOPHPEHURIWKHERDUG RIDSSHDOVRUHPSOR\HHFKDUJHGZLWKWKHHQIRUFHPHQWRIWKLV FRGHZKLOHDFWLQJIRUWKHMXULVGLFWLRQLQJRRGIDLWKDQGZLWK RXWPDOLFHLQWKHGLVFKDUJHRIWKHGXWLHVUHTXLUHGE\WKLVFRGH RURWKHUSHUWLQHQWODZRURUGLQDQFHVKDOOQRWWKHUHE\EHUHQ GHUHGFLYLOO\RUFULPLQDOO\OLDEOHSHUVRQDOO\DQGLVKHUHE\ UHOLHYHGIURPDOOSHUVRQDOOLDELOLW\IRUDQ\GDPDJHDFFUXLQJ WRSHUVRQVRUSURSHUW\DVDUHVXOWRIDQDFWRUE\UHDVRQRIDQ DFWRURPLVVLRQLQWKHGLVFKDUJHRIRIILFLDOGXWLHV >$@/HJDOGHIHQVH$Q\VXLWRUFULPLQDOFRPSODLQW LQVWLWXWHGDJDLQVWDQ\RIILFHURUHPSOR\HHEHFDXVHRIDQ DFWSHUIRUPHGE\WKDWRIILFHURUHPSOR\HHLQWKHODZIXO GLVFKDUJHRIGXWLHVDQGXQGHUWKHSURYLVLRQVRIWKLVFRGH VKDOOEHGHIHQGHGE\WKHOHJDOUHSUHVHQWDWLYHRIWKHMXULV GLFWLRQXQWLOWKHILQDOWHUPLQDWLRQRIWKHSURFHHGLQJV7KH FRGH RIILFLDO RU DQ\ VXERUGLQDWH VKDOO QRW EH OLDEOH IRU FRVWVLQDQDFWLRQVXLWRUSURFHHGLQJWKDWLVLQVWLWXWHGLQ SXUVXDQFHRIWKHSURYLVLRQVRIWKLVFRGH >$@)HHV7KHIHHVIRUDFWLYLWLHVDQGVHUYLFHVSHUIRUPHG E\WKHGHSDUWPHQWLQFDUU\LQJRXWLWVUHVSRQVLELOLWLHVXQGHU WKLVFRGHVKDOOEHDVLQGLFDWHGLQWKHIROORZLQJVFKHGXOH >-85,6',&7,2172,16(57$335235,$7(6&+('8/(@ 6(&7,21 '87,(6$1'32:(562)7+(&2'(2)),&,$/ >$@*HQHUDO7KHFRGHRIILFLDOLVKHUHE\DXWKRUL]HG DQGGLUHFWHGWRHQIRUFHWKHSURYLVLRQVRIWKLVFRGH7KHFRGH RIILFLDOVKDOOKDYHWKHDXWKRULW\WRUHQGHULQWHUSUHWDWLRQVRI WKLVFRGHDQGWRDGRSWSROLFLHVDQGSURFHGXUHVLQRUGHUWR FODULI\WKHDSSOLFDWLRQRILWVSURYLVLRQV6XFKLQWHUSUHWDWLRQV SROLFLHVDQGSURFHGXUHVVKDOOEHLQFRPSOLDQFHZLWKWKHLQWHQW DQGSXUSRVHRIWKLVFRGH6XFKSROLFLHVDQGSURFHGXUHVVKDOO QRWKDYHWKHHIIHFWRIZDLYLQJUHTXLUHPHQWVVSHFLILFDOO\SUR YLGHGIRULQWKLVFRGH >$@,QVSHFWLRQV7KHFRGHRIILFLDOVKDOOPDNHDOORIWKH UHTXLUHGLQVSHFWLRQVRUVKDOODFFHSWUHSRUWVRILQVSHFWLRQE\ DSSURYHGDJHQFLHVRULQGLYLGXDOV5HSRUWVRIVXFKLQVSHFWLRQV VKDOOEHLQZULWLQJDQGEHFHUWLILHGE\DUHVSRQVLEOHRIILFHURI VXFKDSSURYHGDJHQF\RUE\WKHUHVSRQVLEOHLQGLYLGXDO7KH FRGHRIILFLDOLVDXWKRUL]HGWRHQJDJHVXFKH[SHUWRSLQLRQDV GHHPHGQHFHVVDU\WRUHSRUWRQXQXVXDOWHFKQLFDOLVVXHVWKDW DULVHVXEMHFWWRWKHDSSURYDORIWKHDSSRLQWLQJDXWKRULW\ >$@5LJKWRIHQWU\:KHUHLWLVQHFHVVDU\WRPDNHDQ LQVSHFWLRQWRHQIRUFHWKHSURYLVLRQVRIWKLVFRGHRUZKHQHYHU WKHFRGHRIILFLDOKDVUHDVRQDEOHFDXVHWREHOLHYHWKDWWKHUH H[LVWVLQDVWUXFWXUHRUXSRQDSUHPLVHVDFRQGLWLRQLQYLROD WLRQRIWKLVFRGHWKHFRGHRIILFLDOLVDXWKRUL]HGWRHQWHUWKH VWUXFWXUHRUSUHPLVHVDWUHDVRQDEOHWLPHVWRLQVSHFWRUSHU IRUPWKHGXWLHVLPSRVHGE\WKLVFRGHSURYLGHGWKDWLIVXFK VWUXFWXUHRUSUHPLVHVLVRFFXSLHGWKHFRGHRIILFLDOVKDOOSUHV HQW FUHGHQWLDOV WR WKHRFFXSDQW DQG UHTXHVW HQWU\ ,I VXFK VWUXFWXUHRUSUHPLVHVLVXQRFFXSLHGWKHFRGHRIILFLDOVKDOO ILUVWPDNHDUHDVRQDEOHHIIRUWWRORFDWHWKHRZQHURZQHU¶V DXWKRUL]HGDJHQWRURWKHUSHUVRQKDYLQJFKDUJHRUFRQWURORI WKHVWUXFWXUHRUSUHPLVHVDQGUHTXHVWHQWU\,IHQWU\LV UHIXVHGWKHFRGHRIILFLDOVKDOOKDYHUHFRXUVHWRWKHUHPHGLHV SURYLGHGE\ODZWRVHFXUHHQWU\ >$@,GHQWLILFDWLRQ7KHFRGHRIILFLDOVKDOOFDUU\SURSHU LGHQWLILFDWLRQZKHQLQVSHFWLQJVWUXFWXUHVRUSUHPLVHVLQWKH SHUIRUPDQFHRIGXWLHVXQGHUWKLVFRGH >$@1RWLFHVDQGRUGHUV7KHFRGHRIILFLDOVKDOOLVVXH DOOQHFHVVDU\QRWLFHVRURUGHUVWRHQVXUHFRPSOLDQFHZLWKWKLV FRGH >$@'HSDUWPHQWUHFRUGV7KHFRGHRIILFLDOVKDOONHHS RIILFLDOUHFRUGVRIDOOEXVLQHVVDQGDFWLYLWLHVRIWKHGHSDUW PHQWVSHFLILHGLQWKHSURYLVLRQVRIWKLVFRGH6XFKUHFRUGV VKDOOEHUHWDLQHGLQWKHRIILFLDOUHFRUGVIRUWKHSHULRGUHTXLUHG IRUUHWHQWLRQRISXEOLFUHFRUGV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 FRGH WR WKH SUHVFULEHG H[WHQW RI HDFK VXFK UHIHUHQFH DQG DV IXUWKHU UHJXODWHG LQ 6HFWLRQV DQG ([FHSWLRQ:KHUH HQIRUFHPHQW RI D FRGH SURYLVLRQ ZRXOG YLRODWH WKH FRQGLWLRQV RI WKH OLVWLQJ RI WKH HTXLSPHQW RU DSSOLDQFH WKH FRQGLWLRQV RI WKH OLVWLQJ VKDOO DSSO\ >$@ &RQIOLFWV :KHUH FRQIOLFWV RFFXU EHWZHHQ SUR YLVLRQV RI WKLV FRGH DQG WKH UHIHUHQFHG VWDQGDUGV WKH SUR YLVLRQV RI WKLV FRGH VKDOO DSSO\ >$@ 3URYLVLRQV LQ UHIHUHQFHG FRGHV DQG VWDQ GDUGV :KHUH WKH H[WHQW RI WKH UHIHUHQFH WR D UHIHUHQFHG FRGH RU VWDQGDUG LQFOXGHV VXEMHFW PDWWHU WKDW LV ZLWKLQ WKH VFRSH RI WKLV FRGH WKH SURYLVLRQV RI WKLV FRGH DV DSSOLFD EOH VKDOO WDNH SUHFHGHQFH RYHU WKH SURYLVLRQV LQ WKH UHIHU HQFHG FRGH RU VWDQGDUG >$@*HQHUDO 7KH GHSDUWPHQW RI SURSHUW\ PDLQWHQDQFH LQVSHFWLRQ LV KHUHE\ FUHDWHG DQG WKH H[HFXWLYH RIILFLDO LQ FKDUJH WKHUHRI VKDOO EH NQRZQ DV WKH FRGH RIILFLDO >-85,6',&7,21 72 ,16(57 $335235,$7( 6&+('8/( @ 1 2 3 Page: 15 Number: 1 Author: MPoehlman Subject: Replace Date: 7/18/2019 3:08:14 PM -05'00' Appendix D of the City Code. Number: 2 Author: MPoehlman Subject: Replace Date: 1/14/2020 11:38:38 AM Number: 3 Author: MPoehlman Subject: Replace Date: 7/18/2019 3:03:05 PM -05'00' 103.1 General. The City Manager or his or her designee is responsible for administering the provisions of this code. Collectively, these designees shall be known as the Code Official. 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 6(&7,21 $33529$/ >$@ 0RGLILFDWLRQV:KHQHYHUWKHUHDUHSUDFWLFDOGLIIL FXOWLHVLQYROYHGLQFDUU\LQJRXWWKHSURYLVLRQVRIWKLVFRGH WKHFRGHRIILFLDOVKDOOKDYHWKHDXWKRULW\WRJUDQWPRGLILFD WLRQVIRULQGLYLGXDOFDVHVXSRQDSSOLFDWLRQRIWKHRZQHURU RZQHU¶VDXWKRUL]HGDJHQWSURYLGHGWKDWWKHFRGHRIILFLDOVKDOO ILUVWILQGWKDWVSHFLDOLQGLYLGXDOUHDVRQPDNHVWKHVWULFWOHWWHU RIWKLVFRGHLPSUDFWLFDOWKHPRGLILFDWLRQLVLQFRPSOLDQFH ZLWKWKHLQWHQWDQGSXUSRVHRIWKLVFRGHDQGWKDWVXFKPRGLIL FDWLRQ GRHV QRW OHVVHQ KHDOWK OLIH DQG ILUH VDIHW\ UHTXLUH PHQWV7KHGHWDLOVRIDFWLRQJUDQWLQJPRGLILFDWLRQVVKDOOEH UHFRUGHGDQGHQWHUHGLQWKHGHSDUWPHQWILOHV >$@ $OWHUQDWLYHPDWHULDOVGHVLJQDQGPHWKRGVRI FRQVWUXFWLRQDQGHTXLSPHQW7KHSURYLVLRQVRIWKLVFRGH DUHQRWLQWHQGHGWRSUHYHQWWKHLQVWDOODWLRQRIDQ\PDWHULDORU WRSURKLELWDQ\GHVLJQRUPHWKRGRIFRQVWUXFWLRQQRWVSHFLIL FDOO\SUHVFULEHGE\WKLVFRGHSURYLGHGWKDWDQ\VXFKDOWHUQD WLYHKDVEHHQDSSURYHG$QDOWHUQDWLYHPDWHULDOGHVLJQRU PHWKRG RI FRQVWUXFWLRQ VKDOO EHDSSURYHG ZKHUH WKHFRGH RIILFLDO ILQGV WKDW WKH SURSRVHG GHVLJQ LV VDWLVIDFWRU\ DQG FRPSOLHVZLWKWKHLQWHQWRIWKHSURYLVLRQVRIWKLVFRGHDQG WKDWWKHPDWHULDOPHWKRGRUZRUNRIIHUHGLVIRUWKHSXUSRVH LQWHQGHGQRWOHVVWKDQWKHHTXLYDOHQWRIWKDWSUHVFULEHGLQWKLV FRGHLQTXDOLW\VWUHQJWKHIIHFWLYHQHVVILUHUHVLVWDQFHGXUD ELOLW\DQGVDIHW\:KHUHWKHDOWHUQDWLYHPDWHULDOGHVLJQRU PHWKRGRIFRQVWUXFWLRQLVQRWDSSURYHGWKHFRGHRIILFLDOVKDOO UHVSRQGLQZULWLQJVWDWLQJWKHUHDVRQVZK\WKHDOWHUQDWLYH ZDVQRWDSSURYHG >$@ 5HTXLUHGWHVWLQJ:KHQHYHUWKHUHLVLQVXIILFLHQW HYLGHQFHRIFRPSOLDQFHZLWKWKHSURYLVLRQVRIWKLVFRGHRU HYLGHQFHWKDWDPDWHULDORUPHWKRGGRHVQRWFRQIRUPWRWKH UHTXLUHPHQWVRIWKLVFRGHRULQRUGHUWRVXEVWDQWLDWHFODLPV IRUDOWHUQDWLYHPDWHULDOVRUPHWKRGVWKHFRGHRIILFLDOVKDOO KDYHWKHDXWKRULW\WRUHTXLUHWHVWVWREHPDGHDVHYLGHQFHRI FRPSOLDQFHZLWKRXWH[SHQVHWRWKHMXULVGLFWLRQ >$@ 7HVWPHWKRGV7HVWPHWKRGVVKDOOEHDVVSHFL ILHGLQWKLVFRGHRUE\RWKHUUHFRJQL]HGWHVWVWDQGDUGV,Q WKHDEVHQFHRIUHFRJQL]HGDQGDFFHSWHGWHVWPHWKRGVWKH FRGH RIILFLDO VKDOO EH SHUPLWWHG WR DSSURYH DSSURSULDWH WHVWLQJSURFHGXUHVSHUIRUPHGE\DQDSSURYHGDJHQF\ >$@ 7HVWUHSRUWV5HSRUWVRIWHVWVVKDOOEHUHWDLQHG E\WKHFRGHRIILFLDOIRUWKHSHULRGUHTXLUHGIRUUHWHQWLRQRI SXEOLFUHFRUGV >$@ 8VHGPDWHULDODQGHTXLSPHQW0DWHULDOVWKDWDUH UHXVHGVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRIWKLVFRGHIRU QHZPDWHULDOV0DWHULDOVHTXLSPHQWDQGGHYLFHVVKDOOQRWEH UHXVHGXQOHVVVXFKHOHPHQWVDUHLQJRRGUHSDLURUKDYHEHHQ UHFRQGLWLRQHGDQGWHVWHGZKHUHQHFHVVDU\SODFHGLQJRRGDQG SURSHUZRUNLQJFRQGLWLRQDQGDSSURYHGE\WKHFRGHRIILFLDO >$@ $SSURYHGPDWHULDOVDQGHTXLSPHQW0DWHULDOV HTXLSPHQWDQGGHYLFHVDSSURYHGE\WKHFRGHRIILFLDOVKDOOEH FRQVWUXFWHGDQGLQVWDOOHGLQDFFRUGDQFHZLWKVXFKDSSURYDO >$@ 5HVHDUFKUHSRUWV6XSSRUWLQJGDWDZKHUHQHFHV VDU\WRDVVLVWLQWKHDSSURYDORIPDWHULDOVRUDVVHPEOLHVQRW VSHFLILFDOO\SURYLGHGIRULQWKLVFRGHVKDOOFRQVLVWRIYDOLG UHVHDUFKUHSRUWVIURPDSSURYHGVRXUFHV 6(&7,21 9,2/$7,216 >$@ 8QODZIXODFWV,WVKDOOEHXQODZIXOIRUDSHUVRQ ILUPRUFRUSRUDWLRQWREHLQFRQIOLFWZLWKRULQYLRODWLRQRI DQ\RIWKHSURYLVLRQVRIWKLVFRGH >$@ 1RWLFHRIYLRODWLRQ7KHFRGHRIILFLDOVKDOOVHUYHD QRWLFHRIYLRODWLRQRURUGHULQDFFRUGDQFHZLWK6HFWLRQ >$@ 3URVHFXWLRQRIYLRODWLRQ$Q\SHUVRQIDLOLQJWR FRPSO\ZLWKDQRWLFHRIYLRODWLRQRURUGHUVHUYHGLQDFFRU GDQFHZLWK6HFWLRQVKDOOEHGHHPHGJXLOW\RIDPLVGH PHDQRU RU FLYLO LQIUDFWLRQ DV GHWHUPLQHG E\ WKH ORFDO PXQLFLSDOLW\DQGWKHYLRODWLRQVKDOOEHGHHPHGDVWULFWOLDELO LW\RIIHQVH,IWKHQRWLFHRIYLRODWLRQLVQRWFRPSOLHGZLWKWKH FRGHRIILFLDOVKDOOLQVWLWXWHWKHDSSURSULDWHSURFHHGLQJDWODZ RULQHTXLW\WRUHVWUDLQFRUUHFWRUDEDWHVXFKYLRODWLRQRUWR UHTXLUHWKHUHPRYDORUWHUPLQDWLRQRIWKHXQODZIXORFFXSDQF\ RIWKHVWUXFWXUHLQYLRODWLRQRIWKHSURYLVLRQVRIWKLVFRGHRU RIWKHRUGHURUGLUHFWLRQPDGHSXUVXDQWWKHUHWR$Q\DFWLRQ WDNHQE\WKHDXWKRULW\KDYLQJMXULVGLFWLRQRQVXFKSUHPLVHV VKDOOEHFKDUJHGDJDLQVWWKHUHDOHVWDWHXSRQZKLFKWKHVWUXF WXUHLVORFDWHGDQGVKDOOEHDOLHQXSRQVXFKUHDOHVWDWH >$@ 9LRODWLRQSHQDOWLHV$Q\SHUVRQZKRVKDOOYLRODWH DSURYLVLRQRIWKLVFRGHRUIDLOWRFRPSO\WKHUHZLWKRUZLWK DQ\RIWKHUHTXLUHPHQWVWKHUHRIVKDOOEHSURVHFXWHGZLWKLQ WKHOLPLWVSURYLGHGE\VWDWHRUORFDOODZV(DFKGD\WKDWDYLR ODWLRQ FRQWLQXHV DIWHU GXH QRWLFH KDV EHHQ VHUYHG VKDOO EH GHHPHGDVHSDUDWHRIIHQVH >$@ $EDWHPHQWRIYLRODWLRQ7KHLPSRVLWLRQRIWKH SHQDOWLHVKHUHLQSUHVFULEHGVKDOOQRWSUHFOXGHWKHOHJDORIILFHU RI WKH MXULVGLFWLRQ IURP LQVWLWXWLQJ DSSURSULDWH DFWLRQ WR UHVWUDLQ FRUUHFW RU DEDWH D YLRODWLRQ RU WR SUHYHQW LOOHJDO RFFXSDQF\RIDEXLOGLQJVWUXFWXUHRUSUHPLVHVRUWRVWRSDQ LOOHJDODFWFRQGXFWEXVLQHVVRUXWLOL]DWLRQRIWKHEXLOGLQJ VWUXFWXUHRUSUHPLVHV 6(&7,21 127,&(6$1'25'(56 1RWLFHWRSHUVRQUHVSRQVLEOH:KHQHYHUWKHFRGHRIIL FLDOGHWHUPLQHVWKDWWKHUHKDVEHHQDYLRODWLRQRIWKLVFRGHRU KDVJURXQGVWREHOLHYHWKDWDYLRODWLRQKDVRFFXUUHGQRWLFH VKDOOEHJLYHQLQWKHPDQQHUSUHVFULEHGLQ6HFWLRQVDQG WRWKHSHUVRQUHVSRQVLEOHIRUWKHYLRODWLRQDVVSHFLILHG LQWKLVFRGH1RWLFHVIRUFRQGHPQDWLRQSURFHGXUHVVKDOOFRP SO\ZLWK6HFWLRQ )RUP6XFKQRWLFHSUHVFULEHGLQ6HFWLRQVKDOOEH LQDFFRUGDQFHZLWKDOORIWKHIROORZLQJ %HLQZULWLQJ ,QFOXGHDGHVFULSWLRQRIWKHUHDOHVWDWHVXIILFLHQWIRU LGHQWLILFDWLRQ ,QFOXGHDVWDWHPHQWRIWKHYLRODWLRQRUYLRODWLRQVDQG ZK\WKHQRWLFHLVEHLQJLVVXHG ,QFOXGHDFRUUHFWLRQRUGHUDOORZLQJDUHDVRQDEOHWLPHWR PDNHWKHUHSDLUVDQGLPSURYHPHQWVUHTXLUHGWREULQJ WKHGZHOOLQJXQLWRUVWUXFWXUHLQWRFRPSOLDQFHZLWKWKH SURYLVLRQVRIWKLVFRGH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 G VKDOO EH 1 2 3 Page: 16 Number: 1 Author: MPoehlman Subject: Replace Date: 12/23/2019 11:54:21 AM ...may be... Number: 2 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 1:55:10 PM Number: 3 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 1:55:14 PM 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( ,QIRUPWKHSURSHUW\RZQHURURZQHU¶VDXWKRUL]HGDJHQW RIWKHULJKWWRDSSHDO ,QFOXGHDVWDWHPHQWRIWKHULJKWWRILOHDOLHQLQDFFRU GDQFHZLWK6HFWLRQ 0HWKRGRIVHUYLFH6XFKQRWLFHVKDOOEHGHHPHGWREH SURSHUO\VHUYHGLIDFRS\WKHUHRILVGHOLYHUHGSHUVRQDOO\RU VHQW E\ FHUWLILHG RU ILUVWFODVV PDLO DGGUHVVHG WR WKH ODVW NQRZQDGGUHVV,IWKHQRWLFHLVUHWXUQHGVKRZLQJWKDWWKHOHW WHUZDVQRWGHOLYHUHGDFRS\WKHUHRIVKDOOEHSRVWHGLQDFRQ VSLFXRXV SODFH LQ RU DERXW WKH VWUXFWXUH DIIHFWHG E\ VXFK QRWLFH 8QDXWKRUL]HGWDPSHULQJ6LJQVWDJVRUVHDOVSRVWHG RU DIIL[HG E\ WKHFRGH RIILFLDO VKDOO QRW EH PXWLODWHG GHVWUR\HGRUWDPSHUHGZLWKRUUHPRYHGZLWKRXWDXWKRUL]D WLRQIURPWKHFRGHRIILFLDO 3HQDOWLHV3HQDOWLHVIRUQRQFRPSOLDQFHZLWKRUGHUVDQG QRWLFHVVKDOOEHDVVHWIRUWKLQ6HFWLRQ 7UDQVIHURIRZQHUVKLS,WVKDOOEHXQODZIXOIRUWKH RZQHURIDQ\GZHOOLQJXQLWRUVWUXFWXUHZKRKDVUHFHLYHGD FRPSOLDQFHRUGHURUXSRQZKRPDQRWLFHRIYLRODWLRQKDV EHHQVHUYHGWRVHOOWUDQVIHUPRUWJDJHOHDVHRURWKHUZLVHGLV SRVHRIVXFKGZHOOLQJXQLWRUVWUXFWXUHWRDQRWKHUXQWLOWKH SURYLVLRQVRIWKHFRPSOLDQFHRUGHURUQRWLFHRIYLRODWLRQKDYH EHHQ FRPSOLHG ZLWK RU XQWLO VXFKRZQHU RU WKH RZQHU¶V DXWKRUL]HG DJHQW VKDOO ILUVW IXUQLVK WKH JUDQWHH WUDQVIHUHH PRUWJDJHHRUOHVVHHDWUXHFRS\RIDQ\FRPSOLDQFHRUGHURU QRWLFHRIYLRODWLRQLVVXHGE\WKHFRGHRIILFLDODQGVKDOOIXU QLVK WR WKHFRGH RIILFLDO D VLJQHG DQG QRWDUL]HG VWDWHPHQW IURPWKHJUDQWHHWUDQVIHUHHPRUWJDJHHRUOHVVHHDFNQRZO HGJLQJWKHUHFHLSWRIVXFKFRPSOLDQFHRUGHURUQRWLFHRIYLR ODWLRQDQGIXOO\DFFHSWLQJWKHUHVSRQVLELOLW\ZLWKRXWFRQGLWLRQ IRUPDNLQJWKHFRUUHFWLRQVRUUHSDLUVUHTXLUHGE\VXFKFRP SOLDQFHRUGHURUQRWLFHRIYLRODWLRQ 6(&7,21 816$)(6758&785(6$1'(48,30(17 *HQHUDO:KHQDVWUXFWXUHRUHTXLSPHQWLVIRXQGE\ WKHFRGHRIILFLDOWREHXQVDIHRUZKHQDVWUXFWXUHLVIRXQG XQILWIRUKXPDQRFFXSDQF\RULVIRXQGXQODZIXOVXFKVWUXF WXUHVKDOOEHFRQGHPQHGSXUVXDQWWRWKHSURYLVLRQVRIWKLV FRGH 8QVDIHVWUXFWXUHV$QXQVDIHVWUXFWXUHLVRQHWKDW LVIRXQGWREHGDQJHURXVWRWKHOLIHKHDOWKSURSHUW\RU VDIHW\RIWKHSXEOLFRUWKHRFFXSDQWVRIWKHVWUXFWXUHE\QRW SURYLGLQJPLQLPXPVDIHJXDUGVWRSURWHFWRUZDUQRFFX SDQWVLQWKHHYHQWRIILUHRUEHFDXVHVXFKVWUXFWXUHFRQ WDLQV XQVDIH HTXLSPHQW RU LV VR GDPDJHG GHFD\HG GLODSLGDWHGVWUXFWXUDOO\XQVDIHRURIVXFKIDXOW\FRQVWUXF WLRQRUXQVWDEOHIRXQGDWLRQWKDWSDUWLDORUFRPSOHWHFRO ODSVHLVSRVVLEOH 8QVDIH HTXLSPHQW8QVDIH HTXLSPHQW LQFOXGHV DQ\ERLOHUKHDWLQJHTXLSPHQWHOHYDWRUPRYLQJVWDLUZD\ HOHFWULFDOZLULQJRUGHYLFHIODPPDEOHOLTXLGFRQWDLQHUVRU RWKHUHTXLSPHQWRQWKHSUHPLVHVRUZLWKLQWKHVWUXFWXUH WKDWLVLQVXFKGLVUHSDLURUFRQGLWLRQWKDWVXFKHTXLSPHQWLV DKD]DUGWROLIHKHDOWKSURSHUW\RUVDIHW\RIWKHSXEOLFRU RFFXSDQWVRIWKHSUHPLVHVRUVWUXFWXUH 6WUXFWXUHXQILWIRUKXPDQRFFXSDQF\$VWUXF WXUHLVXQILWIRUKXPDQRFFXSDQF\ZKHQHYHUWKHFRGHRIIL FLDO ILQGV WKDW VXFK VWUXFWXUH LV XQVDIH XQODZIXO RU EHFDXVHRIWKHGHJUHHWRZKLFKWKHVWUXFWXUHLVLQGLVUHSDLU RUODFNVPDLQWHQDQFHLVLQVDQLWDU\YHUPLQRUUDWLQIHVWHG FRQWDLQVILOWKDQGFRQWDPLQDWLRQRUODFNVYHQWLODWLRQLOOX PLQDWLRQVDQLWDU\RUKHDWLQJIDFLOLWLHVRURWKHUHVVHQWLDO HTXLSPHQWUHTXLUHGE\WKLVFRGHRUEHFDXVHWKHORFDWLRQ RIWKHVWUXFWXUHFRQVWLWXWHVDKD]DUGWRWKHRFFXSDQWVRIWKH VWUXFWXUHRUWRWKHSXEOLF 8QODZIXOVWUXFWXUH$QXQODZIXOVWUXFWXUHLVRQH IRXQGLQZKROHRULQSDUWWREHRFFXSLHGE\PRUHSHUVRQV WKDQSHUPLWWHGXQGHUWKLVFRGHRUZDVHUHFWHGDOWHUHGRU RFFXSLHGFRQWUDU\WRODZ 'DQJHURXVVWUXFWXUHRUSUHPLVHV)RUWKHSXU SRVHRIWKLVFRGHDQ\VWUXFWXUHRUSUHPLVHVWKDWKDVDQ\RU DOORIWKHFRQGLWLRQVRUGHIHFWVGHVFULEHGDVIROORZVVKDOO EHFRQVLGHUHGWREHGDQJHURXV $Q\ GRRU DLVOH SDVVDJHZD\ VWDLUZD\ H[LW RU RWKHUPHDQVRIHJUHVVWKDWGRHVQRWFRQIRUPWRWKH DSSURYHGEXLOGLQJRUILUHFRGHRIWKHMXULVGLFWLRQ DVUHODWHGWRWKHUHTXLUHPHQWVIRUH[LVWLQJEXLOG LQJV 7KH ZDONLQJ VXUIDFH RI DQ\ DLVOH SDVVDJHZD\ VWDLUZD\ H[LW RU RWKHU PHDQV RI HJUHVV LV VR ZDUSHGZRUQORRVHWRUQRURWKHUZLVHXQVDIHDVWR QRWSURYLGHVDIHDQGDGHTXDWHPHDQVRIHJUHVV $Q\ SRUWLRQRIDEXLOGLQJVWUXFWXUHRU DSSXUWH QDQFHWKDWKDVEHHQGDPDJHGE\ILUHHDUWKTXDNH ZLQGIORRGGHWHULRUDWLRQQHJOHFWDEDQGRQPHQW YDQGDOLVPRUE\DQ\RWKHUFDXVHWRVXFKDQH[WHQW WKDWLWLVOLNHO\WRSDUWLDOO\RUFRPSOHWHO\FROODSVH RUWREHFRPHGHWDFKHGRUGLVORGJHG $Q\SRUWLRQRIDEXLOGLQJRUDQ\PHPEHUDSSXU WHQDQFHRURUQDPHQWDWLRQRQWKHH[WHULRUWKHUHRI WKDWLVQRWRIVXIILFLHQWVWUHQJWKRUVWDELOLW\RULV QRWVRDQFKRUHGDWWDFKHGRUIDVWHQHGLQSODFHVR DVWREHFDSDEOHRIUHVLVWLQJQDWXUDORUDUWLILFLDO ORDGV RI RQH DQG RQHKDOI WKH RULJLQDO GHVLJQHG YDOXH 7KHEXLOGLQJRUVWUXFWXUHRUSDUWRIWKHEXLOGLQJRU VWUXFWXUH EHFDXVH RI GLODSLGDWLRQGHWHULRUDWLRQ GHFD\IDXOW\FRQVWUXFWLRQWKHUHPRYDORUPRYH PHQWRIVRPHSRUWLRQRIWKHJURXQGQHFHVVDU\IRU WKHVXSSRUWRUIRUDQ\RWKHUUHDVRQLVOLNHO\WR SDUWLDOO\RUFRPSOHWHO\FROODSVHRUVRPHSRUWLRQ RIWKHIRXQGDWLRQRUXQGHUSLQQLQJRIWKHEXLOGLQJ RUVWUXFWXUHLVOLNHO\WRIDLORUJLYHZD\ 7KHEXLOGLQJRUVWUXFWXUHRUDQ\SRUWLRQWKHUHRILV FOHDUO\XQVDIHIRULWVXVHDQGRFFXSDQF\ 7KHEXLOGLQJRUVWUXFWXUHLVQHJOHFWHGGDPDJHG GLODSLGDWHG XQVHFXUHG RU DEDQGRQHG VR DV WR EHFRPH DQ DWWUDFWLYH QXLVDQFH WR FKLOGUHQ ZKR PLJKWSOD\LQWKHEXLOGLQJRUVWUXFWXUHWRWKHLUGDQ JHUEHFRPHVDKDUERUIRUYDJUDQWVFULPLQDOVRU LPPRUDOSHUVRQVRUHQDEOHVSHUVRQVWRUHVRUWWR WKHEXLOGLQJRUVWUXFWXUHIRUFRPPLWWLQJDQXLVDQFH RUDQXQODZIXODFW Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 4 5 6 Page: 17 Number: 1 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 1:56:12 PM Number: 2 Author: Melissa P (2nd pass) Date: 12/23/2019 2:06:28 PM Number: 3 Author: MPoehlman Date: 12/23/2019 1:56:07 PM Number: 4 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:01:38 PM 107.7 Additional Applicable Code Sections. The City of Richfield reserves the right to utilize the enforcement and notice processes in Sections 320 and 925 of the Richfield City Code for nuisance and environmental health related violations. Number: 5 Author: MPoehlman Subject: Cross-Out Date: 1/14/2020 2:42:48 PM Number: 6 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:06:18 PM 108.1 General. MSBC Section 1300.0180 shall be used to evaluate unsafe structures and equipment. Enforcement shall be governed by Section 925 of the city code. 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( $Q\ EXLOGLQJ RU VWUXFWXUH KDV EHHQ FRQVWUXFWHG H[LVWVRULVPDLQWDLQHGLQYLRODWLRQRIDQ\VSHFLILF UHTXLUHPHQW RU SURKLELWLRQ DSSOLFDEOH WR VXFK EXLOGLQJ RU VWUXFWXUH SURYLGHG E\ WKHDSSURYHG EXLOGLQJRUILUHFRGHRIWKHMXULVGLFWLRQRURIDQ\ ODZRURUGLQDQFHWRVXFKDQH[WHQWDVWRSUHVHQW HLWKHUDVXEVWDQWLDOULVNRIILUHEXLOGLQJFROODSVHRU DQ\RWKHUWKUHDWWROLIHDQGVDIHW\ $ EXLOGLQJ RU VWUXFWXUH XVHG RU LQWHQGHG WR EH XVHGIRUGZHOOLQJSXUSRVHVEHFDXVHRILQDGHTXDWH PDLQWHQDQFHGLODSLGDWLRQGHFD\GDPDJHIDXOW\ FRQVWUXFWLRQ RU DUUDQJHPHQW LQDGHTXDWH OLJKW YHQWLODWLRQ PHFKDQLFDO RU SOXPELQJ V\VWHP RU RWKHUZLVHLVGHWHUPLQHGE\WKHFRGHRIILFLDOWREH XQVDQLWDU\XQILWIRUKXPDQKDELWDWLRQRULQVXFKD FRQGLWLRQWKDWLVOLNHO\WRFDXVHVLFNQHVVRUGLV HDVH $Q\EXLOGLQJRUVWUXFWXUHEHFDXVHRIDODFNRIVXI ILFLHQWRUSURSHUILUHUHVLVWDQFHUDWHGFRQVWUXFWLRQ ILUHSURWHFWLRQV\VWHPVHOHFWULFDOV\VWHPIXHOFRQ QHFWLRQVPHFKDQLFDOV\VWHPSOXPELQJV\VWHPRU RWKHUFDXVHLVGHWHUPLQHGE\WKHFRGHRIILFLDOWR EHDWKUHDWWROLIHRUKHDOWK $Q\SRUWLRQRIDEXLOGLQJUHPDLQVRQDVLWHDIWHU WKH GHPROLWLRQ RU GHVWUXFWLRQ RI WKH EXLOGLQJ RU VWUXFWXUHRUZKHQHYHUDQ\EXLOGLQJRUVWUXFWXUHLV DEDQGRQHGVRDVWRFRQVWLWXWHVXFKEXLOGLQJRUSRU WLRQWKHUHRIDVDQDWWUDFWLYHQXLVDQFHRUKD]DUGWR WKHSXEOLF &ORVLQJRIYDFDQWVWUXFWXUHV,IWKHVWUXFWXUHLVYDFDQW DQGXQILWIRUKXPDQKDELWDWLRQDQGRFFXSDQF\DQGLVQRWLQ GDQJHURIVWUXFWXUDOFROODSVHWKHFRGHRIILFLDOLVDXWKRUL]HGWR SRVWDSODFDUGRIFRQGHPQDWLRQRQWKHSUHPLVHVDQGRUGHUWKH VWUXFWXUHFORVHGXSVRDVQRWWREHDQDWWUDFWLYHQXLVDQFH 8SRQIDLOXUHRIWKHRZQHURURZQHU¶VDXWKRUL]HGDJHQWWR FORVHXSWKHSUHPLVHVZLWKLQWKHWLPHVSHFLILHGLQWKHRUGHU WKHFRGHRIILFLDOVKDOOFDXVHWKHSUHPLVHVWREHFORVHGDQG VHFXUHGWKURXJKDQ\DYDLODEOHSXEOLFDJHQF\RUE\FRQWUDFWRU DUUDQJHPHQWE\SULYDWHSHUVRQVDQGWKHFRVWWKHUHRIVKDOOEH FKDUJHGDJDLQVWWKHUHDOHVWDWHXSRQZKLFKWKHVWUXFWXUHLV ORFDWHGDQGVKDOOEHDOLHQXSRQVXFKUHDOHVWDWHDQGVKDOOEH FROOHFWHGE\DQ\RWKHUOHJDOUHVRXUFH $XWKRULW\ WR GLVFRQQHFW VHUYLFH XWLOLWLHV7KH FRGHRIILFLDOVKDOOKDYHWKHDXWKRULW\WRDXWKRUL]HGLVFRQ QHFWLRQRIXWLOLW\VHUYLFHWRWKHEXLOGLQJVWUXFWXUHRUV\V WHPUHJXODWHGE\WKLVFRGHDQGWKHUHIHUHQFHGFRGHVDQG VWDQGDUGVVHWIRUWKLQ6HFWLRQLQFDVHRIHPHUJHQF\ ZKHUHQHFHVVDU\WRHOLPLQDWHDQLPPHGLDWHKD]DUGWROLIH RU SURSHUW\ RU ZKHUH VXFK XWLOLW\ FRQQHFWLRQ KDV EHHQ PDGHZLWKRXWDSSURYDO7KHFRGHRIILFLDOVKDOOQRWLI\WKH VHUYLQJ XWLOLW\ DQG ZKHQHYHU SRVVLEOH WKHRZQHURU RZQHU¶VDXWKRUL]HGDJHQWDQGRFFXSDQWRIWKHEXLOGLQJ VWUXFWXUHRUVHUYLFHV\VWHPRIWKHGHFLVLRQWRGLVFRQQHFW SULRUWRWDNLQJVXFKDFWLRQ,IQRWQRWLILHGSULRUWRGLVFRQ QHFWLRQWKHRZQHURZQHU¶VDXWKRUL]HGDJHQWRURFFXSDQW RIWKHEXLOGLQJVWUXFWXUHRUVHUYLFHV\VWHPVKDOOEHQRWLILHG LQZULWLQJDVVRRQDVSUDFWLFDOWKHUHDIWHU 1RWLFH:KHQHYHUWKHFRGHRIILFLDOKDVFRQGHPQHGD VWUXFWXUHRUHTXLSPHQWXQGHUWKHSURYLVLRQVRIWKLVVHFWLRQ QRWLFHVKDOOEHSRVWHGLQDFRQVSLFXRXVSODFHLQRUDERXWWKH VWUXFWXUHDIIHFWHGE\VXFKQRWLFHDQGVHUYHGRQWKHRZQHU RZQHU¶VDXWKRUL]HGDJHQWRUWKHSHUVRQRUSHUVRQVUHVSRQVLEOH IRU WKH VWUXFWXUH RU HTXLSPHQW LQDFFRUGDQFH ZLWK6HFWLRQ ,IWKHQRWLFHSHUWDLQVWRHTXLSPHQWLWVKDOOEHSODFHG RQWKHFRQGHPQHGHTXLSPHQW7KHQRWLFHVKDOOEHLQWKHIRUP SUHVFULEHGLQ6HFWLRQ 3ODFDUGLQJ8SRQIDLOXUHRIWKHRZQHURZQHU¶VDXWKR UL]HGDJHQWRUSHUVRQUHVSRQVLEOHWRFRPSO\ZLWKWKHQRWLFH SURYLVLRQVZLWKLQWKHWLPHJLYHQWKHFRGHRIILFLDOVKDOOSRVW RQWKHSUHPLVHVRURQGHIHFWLYHHTXLSPHQWDSODFDUGEHDULQJ WKHZRUG³&RQGHPQHG´DQGDVWDWHPHQWRIWKHSHQDOWLHVSUR YLGHGIRURFFXS\LQJWKHSUHPLVHVRSHUDWLQJWKHHTXLSPHQWRU UHPRYLQJWKHSODFDUG 3ODFDUGUHPRYDO7KHFRGHRIILFLDOVKDOOUHPRYH WKHFRQGHPQDWLRQSODFDUGZKHQHYHUWKHGHIHFWRUGHIHFWV XSRQZKLFKWKHFRQGHPQDWLRQDQGSODFDUGLQJDFWLRQZHUH EDVHGKDYHEHHQHOLPLQDWHG$Q\SHUVRQZKRGHIDFHVRU UHPRYHVDFRQGHPQDWLRQSODFDUGZLWKRXWWKHDSSURYDORI WKHFRGHRIILFLDOVKDOOEHVXEMHFWWRWKHSHQDOWLHVSURYLGHG E\WKLVFRGH 3URKLELWHGRFFXSDQF\$Q\RFFXSLHGVWUXFWXUHFRQ GHPQHGDQGSODFDUGHGE\WKHFRGHRIILFLDOVKDOOEHYDFDWHGDV RUGHUHGE\WKHFRGHRIILFLDO$Q\SHUVRQZKRVKDOORFFXS\D SODFDUGHGSUHPLVHVRUVKDOORSHUDWHSODFDUGHGHTXLSPHQWDQG DQ\RZQHURZQHU¶VDXWKRUL]HGDJHQWRUSHUVRQUHVSRQVLEOH IRUWKHSUHPLVHVZKRVKDOOOHWDQ\RQHRFFXS\DSODFDUGHG SUHPLVHVRURSHUDWHSODFDUGHGHTXLSPHQWVKDOOEHOLDEOHIRU WKHSHQDOWLHVSURYLGHGE\WKLVFRGH $EDWHPHQWPHWKRGV7KHRZQHURZQHU¶VDXWKRUL]HG DJHQWRSHUDWRURURFFXSDQWRIDEXLOGLQJSUHPLVHVRUHTXLS PHQWGHHPHGXQVDIHE\WKHFRGHRIILFLDOVKDOODEDWHRUFDXVH WREHDEDWHGRUFRUUHFWHGVXFKXQVDIHFRQGLWLRQVHLWKHUE\ UHSDLUUHKDELOLWDWLRQGHPROLWLRQRURWKHUDSSURYHGFRUUHFWLYH DFWLRQ 5HFRUG7KHFRGHRIILFLDOVKDOOFDXVHDUHSRUWWREH ILOHGRQDQXQVDIHFRQGLWLRQ7KHUHSRUWVKDOOVWDWHWKHRFFX SDQF\RIWKHVWUXFWXUHDQGWKHQDWXUHRIWKHXQVDIHFRQGLWLRQ 6(&7,21 (0(5*(1&<0($685(6 ,PPLQHQWGDQJHU:KHQLQWKHRSLQLRQRIWKHFRGH RIILFLDOWKHUHLVLPPLQHQWGDQJHURIIDLOXUHRUFROODSVHRID EXLOGLQJRUVWUXFWXUHWKDWHQGDQJHUVOLIHRUZKHQDQ\VWUXF WXUHRUSDUWRIDVWUXFWXUHKDVIDOOHQDQGOLIHLVHQGDQJHUHGE\ WKHRFFXSDWLRQRIWKHVWUXFWXUHRUZKHQWKHUHLVDFWXDORU SRWHQWLDOGDQJHU WR WKHEXLOGLQJRFFXSDQWV RU WKRVHLQ WKH SUR[LPLW\RIDQ\VWUXFWXUHEHFDXVHRIH[SORVLYHVH[SORVLYH IXPHV RU YDSRUV RU WKH SUHVHQFH RI WR[LF IXPHV JDVHV RU PDWHULDOVRURSHUDWLRQRIGHIHFWLYHRUGDQJHURXVHTXLSPHQW WKHFRGHRIILFLDOLVKHUHE\DXWKRUL]HGDQGHPSRZHUHGWRRUGHU DQGUHTXLUHWKHRFFXSDQWVWRYDFDWHWKHSUHPLVHVIRUWKZLWK 7KHFRGHRIILFLDOVKDOOFDXVHWREHSRVWHGDWHDFKHQWUDQFHWR VXFKVWUXFWXUHDQRWLFHUHDGLQJDVIROORZV³7KLV6WUXFWXUH,V 8QVDIHDQG,WV2FFXSDQF\+DV%HHQ3URKLELWHGE\WKH&RGH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 Page: 18 Number: 1 Author: Melissa P (2nd pass) Date: 12/23/2019 2:06:53 PM Number: 2 Author: Melissa P (2nd pass) Date: 12/23/2019 2:08:01 PM Number: 3 Author: Melissa P (2nd pass) Date: 12/23/2019 2:07:39 PM 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 2IILFLDO´,WVKDOOEHXQODZIXOIRUDQ\SHUVRQWRHQWHUVXFK VWUXFWXUH H[FHSW IRU WKH SXUSRVH RI VHFXULQJ WKH VWUXFWXUH PDNLQJWKHUHTXLUHGUHSDLUVUHPRYLQJWKHKD]DUGRXVFRQGL WLRQRURIGHPROLVKLQJWKHVDPH 7HPSRUDU\VDIHJXDUGV1RWZLWKVWDQGLQJRWKHUSURYL VLRQVRIWKLVFRGHZKHQHYHULQWKHRSLQLRQRIWKHFRGHRIIL FLDOWKHUHLVLPPLQHQWGDQJHUGXHWRDQXQVDIHFRQGLWLRQWKH FRGH RIILFLDO VKDOO RUGHU WKH QHFHVVDU\ ZRUN WR EH GRQH LQFOXGLQJWKHERDUGLQJXSRIRSHQLQJVWRUHQGHUVXFKVWUXF WXUH WHPSRUDULO\ VDIH ZKHWKHU RU QRW WKH OHJDO SURFHGXUH KHUHLQ GHVFULEHG KDV EHHQ LQVWLWXWHG DQG VKDOO FDXVH VXFK RWKHUDFWLRQWREHWDNHQDVWKHFRGHRIILFLDOGHHPVQHFHVVDU\ WRPHHWVXFKHPHUJHQF\ &ORVLQJVWUHHWV:KHQQHFHVVDU\IRUSXEOLFVDIHW\WKH FRGHRIILFLDOVKDOOWHPSRUDULO\FORVHVWUXFWXUHVDQGFORVHRU RUGHUWKHDXWKRULW\KDYLQJMXULVGLFWLRQWRFORVHVLGHZDONV VWUHHWVSXEOLFZD\VDQGSODFHVDGMDFHQWWRXQVDIHVWUXFWXUHV DQGSURKLELWWKHVDPHIURPEHLQJXWLOL]HG (PHUJHQF\UHSDLUV)RUWKHSXUSRVHVRIWKLVVHFWLRQ WKHFRGHRIILFLDOVKDOOHPSOR\WKHQHFHVVDU\ODERUDQGPDWHUL DOVWRSHUIRUPWKHUHTXLUHGZRUNDVH[SHGLWLRXVO\DVSRVVLEOH &RVWVRIHPHUJHQF\UHSDLUV&RVWVLQFXUUHGLQWKHSHU IRUPDQFHRIHPHUJHQF\ZRUNVKDOOEHSDLGE\WKHMXULVGLF WLRQ 7KH OHJDO FRXQVHO RI WKH MXULVGLFWLRQ VKDOO LQVWLWXWH DSSURSULDWH DFWLRQ DJDLQVW WKHRZQHURIWKHSUHPLVHVRU RZQHU¶VDXWKRUL]HGDJHQWZKHUHWKHXQVDIHVWUXFWXUHLVRUZDV ORFDWHGIRUWKHUHFRYHU\RIVXFKFRVWV +HDULQJ$Q\SHUVRQRUGHUHGWRWDNHHPHUJHQF\PHD VXUHVVKDOOFRPSO\ZLWKVXFKRUGHUIRUWKZLWK$Q\DIIHFWHG SHUVRQVKDOOWKHUHDIWHUXSRQSHWLWLRQGLUHFWHGWRWKHDSSHDOV ERDUGEHDIIRUGHGDKHDULQJDVGHVFULEHGLQWKLVFRGH 6(&7,21 '(02/,7,21 *HQHUDO7KHFRGHRIILFLDOVKDOORUGHUWKHRZQHURU RZQHU¶V DXWKRUL]HG DJHQW RI DQ\SUHPLVHV XSRQ ZKLFK LV ORFDWHGDQ\VWUXFWXUHZKLFKLQWKHFRGHRIILFLDO¶VRURZQHU¶V DXWKRUL]HGDJHQWMXGJPHQWDIWHUUHYLHZLVVRGHWHULRUDWHGRU GLODSLGDWHGRUKDVEHFRPHVRRXWRIUHSDLUDVWREHGDQJHURXV XQVDIHLQVDQLWDU\RURWKHUZLVHXQILWIRUKXPDQKDELWDWLRQRU RFFXSDQF\ DQG VXFK WKDW LW LV XQUHDVRQDEOH WR UHSDLU WKH VWUXFWXUHWRGHPROLVKDQGUHPRYHVXFKVWUXFWXUHRULIVXFK VWUXFWXUHLVFDSDEOHRIEHLQJPDGHVDIHE\UHSDLUVWRUHSDLU DQGPDNHVDIHDQGVDQLWDU\RUWRERDUGXSDQGKROGIRUIXWXUH UHSDLURUWRGHPROLVKDQGUHPRYHDWWKHRZQHU¶VRSWLRQRU ZKHUHWKHUHKDVEHHQDFHVVDWLRQRIQRUPDOFRQVWUXFWLRQRI DQ\VWUXFWXUHIRUDSHULRGRIPRUHWKDQWZR\HDUVWKHFRGH RIILFLDOVKDOORUGHUWKHRZQHURURZQHU¶VDXWKRUL]HGDJHQWWR GHPROLVKDQGUHPRYHVXFKVWUXFWXUHRUERDUGXSXQWLOIXWXUH UHSDLU%RDUGLQJWKHEXLOGLQJXSIRUIXWXUHUHSDLUVKDOOQRW H[WHQG EH\RQG RQH \HDU XQOHVVDSSURYHG E\ WKH EXLOGLQJ RIILFLDO 1RWLFHVDQGRUGHUV1RWLFHVDQGRUGHUVVKDOOFRPSO\ ZLWK6HFWLRQ )DLOXUH WR FRPSO\,IWKHRZQHU RI DSUHPLVHVRU RZQHU¶VDXWKRUL]HGDJHQWIDLOVWRFRPSO\ZLWKDGHPROLWLRQ RUGHUZLWKLQWKHWLPHSUHVFULEHGWKHFRGHRIILFLDOVKDOOFDXVH WKHVWUXFWXUHWREHGHPROLVKHGDQGUHPRYHGHLWKHUWKURXJKDQ DYDLODEOHSXEOLFDJHQF\RUE\FRQWUDFWRUDUUDQJHPHQWZLWK SULYDWHSHUVRQVDQGWKHFRVWRIVXFKGHPROLWLRQDQGUHPRYDO VKDOOEHFKDUJHGDJDLQVWWKHUHDOHVWDWHXSRQZKLFKWKHVWUXF WXUHLVORFDWHGDQGVKDOOEHDOLHQXSRQVXFKUHDOHVWDWH 6DOYDJH PDWHULDOV:KHUHDQ\VWUXFWXUHKDVEHHQ RUGHUHG GHPROLVKHG DQG UHPRYHG WKH JRYHUQLQJ ERG\ RU RWKHUGHVLJQDWHGRIILFHUXQGHUVDLGFRQWUDFWRUDUUDQJHPHQW DIRUHVDLGVKDOOKDYHWKHULJKWWRVHOOWKHVDOYDJHDQGYDOXDEOH PDWHULDOV7KHQHWSURFHHGVRIVXFKVDOHDIWHUGHGXFWLQJWKH H[SHQVHVRIVXFKGHPROLWLRQDQGUHPRYDOVKDOOEHSURPSWO\ UHPLWWHGZLWKDUHSRUWRIVXFKVDOHRUWUDQVDFWLRQLQFOXGLQJ WKHLWHPVRIH[SHQVHDQGWKHDPRXQWVGHGXFWHGIRUWKHSHU VRQZKRLVHQWLWOHGWKHUHWRVXEMHFWWRDQ\RUGHURIDFRXUW,I VXFKDVXUSOXVGRHVQRWUHPDLQWREHWXUQHGRYHUWKHUHSRUW VKDOOVRVWDWH 6(&7,21 0($162)$33($/ >$@ $SSOLFDWLRQ IRU DSSHDO$Q\SHUVRQGLUHFWO\ DIIHFWHGE\DGHFLVLRQRIWKHFRGHRIILFLDORUDQRWLFHRURUGHU LVVXHGXQGHUWKLVFRGHVKDOOKDYHWKHULJKWWRDSSHDOWRWKH ERDUG RI DSSHDOV SURYLGHG WKDW D ZULWWHQ DSSOLFDWLRQ IRU DSSHDOLVILOHGZLWKLQGD\VDIWHUWKHGD\WKHGHFLVLRQ QRWLFHRURUGHUZDVVHUYHG$QDSSOLFDWLRQIRUDSSHDOVKDOOEH EDVHGRQDFODLPWKDWWKHWUXHLQWHQWRIWKLVFRGHRUWKHUXOHV OHJDOO\DGRSWHGWKHUHXQGHUKDYHEHHQLQFRUUHFWO\LQWHUSUHWHG WKHSURYLVLRQVRIWKLVFRGHGRQRWIXOO\DSSO\RUWKHUHTXLUH PHQWVRIWKLVFRGHDUHDGHTXDWHO\VDWLVILHGE\RWKHUPHDQV >$@0HPEHUVKLSRIERDUG7KHERDUGRIDSSHDOVVKDOO FRQVLVWRIQRWOHVVWKDQWKUHHPHPEHUVZKRDUHTXDOLILHGE\ H[SHULHQFHDQGWUDLQLQJWRSDVVRQPDWWHUVSHUWDLQLQJWRSURS HUW\PDLQWHQDQFHDQGZKRDUHQRWHPSOR\HHVRIWKHMXULVGLF WLRQ7KHFRGHRIILFLDOVKDOOEHDQH[RIILFLRPHPEHUEXWVKDOO QRWYRWHRQDQ\PDWWHUEHIRUHWKHERDUG7KHERDUGVKDOOEH DSSRLQWHGE\WKHFKLHIDSSRLQWLQJDXWKRULW\DQGVKDOOVHUYH VWDJJHUHGDQGRYHUODSSLQJWHUPV >$@ $OWHUQDWH PHPEHUV 7KH FKLHI DSSRLQWLQJ DXWKRULW\VKDOODSSRLQWQRWOHVVWKDQWZRDOWHUQDWHPHPEHUV ZKRVKDOOEHFDOOHGE\WKHERDUGFKDLUPDQWRKHDUDSSHDOV GXULQJWKHDEVHQFHRUGLVTXDOLILFDWLRQRIDPHPEHU$OWHU QDWHPHPEHUVVKDOOSRVVHVVWKHTXDOLILFDWLRQVUHTXLUHGIRU ERDUGPHPEHUVKLS >$@&KDLUPDQ7KHERDUGVKDOODQQXDOO\VHOHFW RQHRILWVPHPEHUVWRVHUYHDVFKDLUPDQ >$@'LVTXDOLILFDWLRQRIPHPEHU$PHPEHUVKDOO QRWKHDUDQDSSHDOLQZKLFKWKDWPHPEHUKDVDSHUVRQDO SURIHVVLRQDORUILQDQFLDOLQWHUHVW >$@ 6HFUHWDU\ 7KHFKLHI DGPLQLVWUDWLYH RIILFHU VKDOOGHVLJQDWHDTXDOLILHGSHUVRQWRVHUYHDVVHFUHWDU\WR WKHERDUG7KHVHFUHWDU\VKDOOILOHDGHWDLOHGUHFRUGRIDOO SURFHHGLQJVLQWKHRIILFHRIWKHFKLHIDGPLQLVWUDWLYHRIIL FHU >$@&RPSHQVDWLRQRIPHPEHUV&RPSHQVDWLRQ RIPHPEHUVVKDOOEHGHWHUPLQHGE\ODZ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 Page: 19 Number: 1 Author: Melissa P (2nd pass) Date: 12/23/2019 2:14:23 PM per the provisions of Section 320 of the city code. Number: 2 Author: MPoehlman Subject: Cross-Out Date: 1/14/2020 2:47:15 PM Number: 3 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 2:11:59 PM 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( >$@ 1RWLFH RI PHHWLQJ 7KH ERDUG VKDOO PHHW XSRQ QRWLFHIURPWKHFKDLUPDQZLWKLQGD\VRIWKHILOLQJRIDQ DSSHDORUDWVWDWHGSHULRGLFPHHWLQJV >$@2SHQKHDULQJ+HDULQJVEHIRUHWKHERDUGVKDOOEH RSHQWRWKHSXEOLF7KHDSSHOODQWWKHDSSHOODQW¶VUHSUHVHQWD WLYH WKHFRGH RIILFLDO DQG DQ\ SHUVRQ ZKRVH LQWHUHVWV DUH DIIHFWHGVKDOOEHJLYHQDQRSSRUWXQLW\WREHKHDUG$TXRUXP VKDOOFRQVLVWRIQRWOHVVWKDQWZRWKLUGVRIWKHERDUGPHPEHU VKLS >$@3URFHGXUH7KHERDUGVKDOODGRSWDQGPDNH DYDLODEOHWRWKHSXEOLFWKURXJKWKHVHFUHWDU\SURFHGXUHV XQGHUZKLFKDKHDULQJZLOOEHFRQGXFWHG7KHSURFHGXUHV VKDOOQRWUHTXLUHFRPSOLDQFHZLWKVWULFWUXOHVRIHYLGHQFH EXW VKDOO PDQGDWH WKDW RQO\ UHOHYDQW LQIRUPDWLRQ EH UHFHLYHG >$@3RVWSRQHGKHDULQJ:KHQWKHIXOOERDUGLVQRW SUHVHQWWRKHDUDQDSSHDOHLWKHUWKHDSSHOODQWRUWKHDSSHO ODQW¶VUHSUHVHQWDWLYHVKDOOKDYHWKHULJKWWRUHTXHVWDSRVW SRQHPHQWRIWKHKHDULQJ >$@%RDUGGHFLVLRQ7KHERDUGVKDOOPRGLI\RUUHYHUVH WKHGHFLVLRQRIWKHFRGHRIILFLDORQO\E\DFRQFXUULQJYRWHRID PDMRULW\RIWKHWRWDOQXPEHURIDSSRLQWHGERDUGPHPEHUV >$@ 5HFRUGV DQG FRSLHV 7KH GHFLVLRQ RI WKH ERDUGVKDOOEHUHFRUGHG&RSLHVVKDOOEHIXUQLVKHGWRWKH DSSHOODQWDQGWRWKHFRGHRIILFLDO >$@$GPLQLVWUDWLRQ7KHFRGHRIILFLDOVKDOOWDNH LPPHGLDWHDFWLRQLQDFFRUGDQFHZLWKWKHGHFLVLRQRIWKH ERDUG >$@&RXUWUHYLHZ$Q\SHUVRQZKHWKHURUQRWDSUHYL RXVSDUW\RIWKHDSSHDOVKDOOKDYHWKHULJKWWRDSSO\WRWKH DSSURSULDWHFRXUWIRUDZULWRIFHUWLRUDULWRFRUUHFWHUURUVRI ODZ$SSOLFDWLRQIRUUHYLHZVKDOOEHPDGHLQWKHPDQQHUDQG WLPHUHTXLUHGE\ODZIROORZLQJWKHILOLQJRIWKHGHFLVLRQLQ WKHRIILFHRIWKHFKLHIDGPLQLVWUDWLYHRIILFHU >$@ 6WD\V RI HQIRUFHPHQW $SSHDOV RI QRWLFH DQG RUGHUVRWKHUWKDQ,PPLQHQW'DQJHUQRWLFHVVKDOOVWD\WKH HQIRUFHPHQWRIWKHQRWLFHDQGRUGHUXQWLOWKHDSSHDOLVKHDUG E\WKHDSSHDOVERDUG 6(&7,21 6723:25.25'(5 >$@$XWKRULW\:KHQHYHUWKHFRGHRIILFLDOILQGVDQ\ ZRUNUHJXODWHGE\WKLVFRGHEHLQJSHUIRUPHGLQDPDQQHU FRQWUDU\WRWKHSURYLVLRQVRIWKLVFRGHRULQDGDQJHURXVRU XQVDIHPDQQHUWKHFRGHRIILFLDOLVDXWKRUL]HGWRLVVXHDVWRS ZRUNRUGHU >$@,VVXDQFH$VWRSZRUNRUGHUVKDOOEHLQZULWLQJDQG VKDOOEHJLYHQWRWKHRZQHURIWKHSURSHUW\WRWKHRZQHU¶V DXWKRUL]HGDJHQWRUWRWKHSHUVRQGRLQJWKHZRUN8SRQLVVX DQFHRIDVWRSZRUNRUGHUWKHFLWHGZRUNVKDOOLPPHGLDWHO\ FHDVH7KHVWRSZRUNRUGHUVKDOOVWDWHWKHUHDVRQIRUWKHRUGHU DQGWKHFRQGLWLRQVXQGHUZKLFKWKHFLWHGZRUNLVDXWKRUL]HG WRUHVXPH >$@ (PHUJHQFLHV :KHUH DQ HPHUJHQF\ H[LVWV WKH FRGHRIILFLDOVKDOOQRWEHUHTXLUHGWRJLYHDZULWWHQQRWLFH SULRUWRVWRSSLQJWKHZRUN >$@)DLOXUHWRFRPSO\$Q\SHUVRQZKRVKDOOFRQWLQXH DQ\ZRUNDIWHUKDYLQJEHHQVHUYHGZLWKDVWRSZRUNRUGHU H[FHSWVXFK ZRUNDVWKDWSHUVRQLVGLUHFWHGWRSHUIRUP WR UHPRYHDYLRODWLRQRUXQVDIHFRQGLWLRQVKDOOEHOLDEOHWRD ILQHRIQRWOHVVWKDQ>$02817@GROODUVRUPRUHWKDQ>$02817@ GROODUV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 Page: 20 Number: 1 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 2:10:22 PM Number: 2 Author: Melissa P (2nd pass) Date: 12/23/2019 2:10:59 PM Number: 3 Author: Melissa P (2nd pass) Date: 12/23/2019 2:10:56 PM ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 '(),1,7,216 User note: About this chapter:Codes, by their very nature, are technical documents. Every word, term and punctuation mark can add to or change the meaning of a technical requirement. It is necessary to maintain a consensus on the specific meaning of each term contained in the code. Chapter 2 performs this function by stating clearly what specific terms mean for the purpose of the code. 6(&7,21 *(1(5$/ 6FRSH8QOHVVRWKHUZLVHH[SUHVVO\VWDWHGWKHIROORZ LQJWHUPVVKDOOIRUWKHSXUSRVHVRIWKLVFRGHKDYHWKHPHDQ LQJVVKRZQLQWKLVFKDSWHU ,QWHUFKDQJHDELOLW\:RUGVVWDWHGLQWKHSUHVHQWWHQVH LQFOXGH WKH IXWXUH ZRUGV VWDWHG LQ WKH PDVFXOLQH JHQGHU LQFOXGHWKHIHPLQLQHDQGQHXWHUWKHVLQJXODUQXPEHULQFOXGHV WKHSOXUDODQGWKHSOXUDOWKHVLQJXODU 7HUPVGHILQHGLQRWKHUFRGHV:KHUHWHUPVDUHQRW GHILQHG LQ WKLV FRGH DQG DUH GHILQHG LQ WKH,QWHUQDWLRQDO %XLOGLQJ&RGH,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ&RGH,QWHU QDWLRQDO)LUH&RGH,QWHUQDWLRQDO)XHO*DV&RGH,QWHUQD WLRQDO 0HFKDQLFDO &RGH ,QWHUQDWLRQDO 3OXPELQJ &RGH ,QWHUQDWLRQDO5HVLGHQWLDO&RGH,QWHUQDWLRQDO=RQLQJ&RGHRU 1)3$VXFKWHUPVVKDOOKDYHWKHPHDQLQJVDVFULEHGWR WKHPDVVWDWHGLQWKRVHFRGHV 7HUPV QRW GHILQHG :KHUH WHUPV DUH QRW GHILQHG WKURXJKWKHPHWKRGVDXWKRUL]HGE\WKLVVHFWLRQVXFKWHUPV VKDOOKDYHRUGLQDULO\DFFHSWHGPHDQLQJVVXFKDVWKHFRQWH[W LPSOLHV 3DUWV:KHQHYHUWKHZRUGV³GZHOOLQJXQLW´³GZHOO LQJ´ ³SUHPLVHV´ ³EXLOGLQJ´ ³URRPLQJ KRXVH´ ³URRPLQJ XQLW´³KRXVHNHHSLQJXQLW´RU³VWRU\´DUHVWDWHGLQWKLVFRGH WKH\VKDOOEHFRQVWUXHGDVWKRXJKWKH\ZHUHIROORZHGE\WKH ZRUGV³RUDQ\SDUWWKHUHRI´ 6(&7,21 *(1(5$/'(),1,7,216 $1&+25('6HFXUHGLQDPDQQHUWKDWSURYLGHVSRVLWLYH FRQQHFWLRQ >$@$33529('$FFHSWDEOHWRWKHFRGHRIILFLDO %$6(0(17 7KDW SRUWLRQ RI DEXLOGLQJ WKDW LV SDUWO\ RU FRPSOHWHO\EHORZJUDGH %$7+5220$URRPFRQWDLQLQJSOXPELQJIL[WXUHVLQFOXG LQJDEDWKWXERUVKRZHU %('5220$Q\URRPRUVSDFHXVHGRULQWHQGHGWREHXVHG IRUVOHHSLQJSXUSRVHVLQHLWKHUDGZHOOLQJRUVOHHSLQJXQLW >$@&2'(2)),&,$/7KHRIILFLDOZKRLVFKDUJHGZLWKWKH DGPLQLVWUDWLRQ DQG HQIRUFHPHQW RI WKLV FRGH RU DQ\ GXO\ DXWKRUL]HGUHSUHVHQWDWLYH &21'(017RDGMXGJHXQILWIRURFFXSDQF\ &267 2) 68&+ '(02/,7,21 25 (0(5*(1&< 5(3$,567KHFRVWVVKDOOLQFOXGHWKHDFWXDOFRVWVRIWKH GHPROLWLRQRUUHSDLURIWKHVWUXFWXUHOHVVUHYHQXHVREWDLQHGLI VDOYDJHZDVFRQGXFWHGSULRUWRGHPROLWLRQRUUHSDLU&RVWV VKDOO LQFOXGH EXW QRW EH OLPLWHG WR H[SHQVHV LQFXUUHG RU QHFHVVLWDWHGUHODWHGWRGHPROLWLRQRUHPHUJHQF\UHSDLUVVXFK DV DVEHVWRV VXUYH\ DQG DEDWHPHQW LI QHFHVVDU\ FRVWV RI LQVSHFWRUVWHVWLQJDJHQFLHVRUH[SHUWVUHWDLQHGUHODWLYHWRWKH GHPROLWLRQRUHPHUJHQF\UHSDLUVFRVWVRIWHVWLQJVXUYH\VIRU RWKHUPDWHULDOVWKDWDUHFRQWUROOHGRUUHJXODWHGIURPEHLQJ GXPSHG LQ D ODQGILOO WLWOH VHDUFKHV PDLOLQJV SRVWLQJV UHFRUGLQJDQGDWWRUQH\IHHVH[SHQGHGIRUUHFRYHULQJRIWKH FRVWRIHPHUJHQF\UHSDLUVRUWRREWDLQRUHQIRUFHDQRUGHURI GHPROLWLRQPDGHE\DFRGHRIILFLDOWKHJRYHUQLQJERG\RU ERDUGRIDSSHDOV '(7$&+(':KHQDVWUXFWXUDOHOHPHQWLVSK\VLFDOO\GLV FRQQHFWHGIURPDQRWKHUDQGWKDWFRQQHFWLRQLVQHFHVVDU\WR SURYLGHDSRVLWLYHFRQQHFWLRQ '(7(5,25$7,217RZHDNHQGLVLQWHJUDWHFRUURGHUXVW RUGHFD\DQGORVHHIIHFWLYHQHVV >%*@':(//,1*81,7$VLQJOHXQLWSURYLGLQJFRPSOHWH LQGHSHQGHQWOLYLQJIDFLOLWLHVIRURQHRUPRUHSHUVRQVLQFOXG LQJSHUPDQHQWSURYLVLRQVIRUOLYLQJVOHHSLQJHDWLQJFRRNLQJ DQGVDQLWDWLRQ >=@($6(0(177KDWSRUWLRQRIODQGRUSURSHUW\UHVHUYHG IRUSUHVHQWRUIXWXUHXVHE\DSHUVRQRUDJHQF\RWKHUWKDQWKH OHJDOIHHRZQHUVRIWKHSURSHUW\7KHHDVHPHQWVKDOOEHSHU PLWWHGWREHIRUXVHXQGHURQRUDERYHVDLGORWRUORWV (48,30(17 68332577KRVH VWUXFWXUDO PHPEHUV RU DVVHPEOLHVRIPHPEHUVRUPDQXIDFWXUHGHOHPHQWVLQFOXGLQJ EUDFHVIUDPHVOXJVVQXJJHUVKDQJHUVRUVDGGOHVWKDWWUDQV PLWJUDYLW\ORDGODWHUDOORDGDQGRSHUDWLQJORDGEHWZHHQWKH HTXLSPHQWDQGWKHVWUXFWXUH (;7(5,253523(57<7KHRSHQVSDFHRQWKHSUHPLVHV DQG RQ DGMRLQLQJ SURSHUW\ XQGHU WKH FRQWURO RIRZQHUVRU RSHUDWRUVRIVXFKSUHPLVHV *$5%$*(7KHDQLPDORUYHJHWDEOHZDVWHUHVXOWLQJIURP WKHKDQGOLQJSUHSDUDWLRQFRRNLQJDQGFRQVXPSWLRQRIIRRG >%(@*8$5'$EXLOGLQJFRPSRQHQWRUDV\VWHPRIEXLOG LQJFRPSRQHQWVORFDWHGDWRUQHDUWKHRSHQVLGHVRIHOHYDWHG ZDONLQJVXUIDFHVWKDWPLQLPL]HVWKHSRVVLELOLW\RIDIDOOIURP WKHZDONLQJVXUIDFHWRDORZHUOHYHO >%*@+$%,7$%/(63$&(6SDFHLQDVWUXFWXUHIRUOLYLQJ VOHHSLQJHDWLQJRUFRRNLQJ%DWKURRPVWRLOHWURRPVFORVHWV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 7HUPV GHILQHG LQ RWKHU FRGHV :KHUH WHUPV DUH QRW GHILQHG LQ WKLV FRGH DQG DUH GHILQHG LQ WKH ,QWHUQDWLRQDO %XLOGLQJ &RGH ,QWHUQDWLRQDO ([LVWLQJ %XLOGLQJ &RGH ,QWHU QDWLRQDO )LUH &RGH ,QWHUQDWLRQDO )XHO *DV &RGH ,QWHUQD WLRQDO 0HFKDQLFDO &RGH ,QWHUQDWLRQDO 3OXPELQJ &RGH ,QWHUQDWLRQDO 5HVLGHQWLDO &RGH ,QWHUQDWLRQDO =RQLQJ &RGH RU 1)3$ VXFK WHUPV VKDOO KDYH WKH PHDQLQJV DVFULEHG WR WKHP DV VWDWHG LQ WKRVH FRGHV 1 2 3 Page: 22 Number: 1 Author: MPoehlman Subject: Replace Date: 1/14/2020 2:56:53 PM 201.3. Terms defined in other codes. Where terms are not defined in this code and are defined in the MSBC and the City Code, such terms shall have the meanings ascribed to them in those codes. Number: 2 Author: Melissa P (2nd pass) Date: 12/23/2019 2:22:01 PM (also see "Rubbish." Garbage and Rubbish shall be taken to encompass both definitions herein.) Author: Jennifer Date: 10/9/2019 12:44:08 PM -05'00' city code section 601 is currently being amended by Rachel Lindholm to eliminate the definition of refuse and change the definition of garbage among other changes. Mary is aware of this but we need to make sure this all meshes. Number: 3 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:22:25 PM (Also see "Rubbish." Garbage and Rubbish shall be taken to encompass both definitions herein.) '(),1,7,216 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( KDOOVVWRUDJHRUXWLOLW\VSDFHVDQGVLPLODUDUHDVDUHQRWFRQ VLGHUHGKDELWDEOHVSDFHV +,6725,&%8,/',1*$Q\EXLOGLQJRUVWUXFWXUHWKDWLV RQHRUPRUHRIWKHIROORZLQJ /LVWHGRUFHUWLILHGDVHOLJLEOHIRUOLVWLQJE\WKH6WDWH +LVWRULF 3UHVHUYDWLRQ 2IILFHU RU WKH .HHSHU RI WKH 1DWLRQDO5HJLVWHURI+LVWRULF3ODFHVLQWKH1DWLRQDO 5HJLVWHURI+LVWRULF3ODFHV 'HVLJQDWHGDVKLVWRULFXQGHUDQDSSOLFDEOHVWDWHRUORFDO ODZ &HUWLILHGDVDFRQWULEXWLQJUHVRXUFHZLWKLQD1DWLRQDO 5HJLVWHURUVWDWHRUORFDOO\GHVLJQDWHGKLVWRULFGLVWULFW +286(.((3,1*81,7$URRPRUJURXSRIURRPVIRUP LQJDVLQJOHKDELWDEOHVSDFHHTXLSSHGDQGLQWHQGHGWREHXVHG IRUOLYLQJVOHHSLQJFRRNLQJDQGHDWLQJWKDWGRHVQRWFRQWDLQ ZLWKLQVXFKDXQLWDWRLOHWODYDWRU\DQGEDWKWXERUVKRZHU ,00,1(17'$1*(5$FRQGLWLRQWKDWFRXOGFDXVHVHUL RXVRUOLIHWKUHDWHQLQJLQMXU\RUGHDWKDWDQ\WLPH ,1)(67$7,217KHSUHVHQFHZLWKLQRUFRQWLJXRXVWRD VWUXFWXUH RUSUHPLVHV RI LQVHFWV URGHQWV YHUPLQ RU RWKHU SHVWV ,123(5$%/(027259(+,&/($YHKLFOHWKDWFDQQRW EHGULYHQXSRQWKHSXEOLFVWUHHWVIRUUHDVRQLQFOXGLQJEXWQRW OLPLWHGWREHLQJXQOLFHQVHGZUHFNHGDEDQGRQHGLQDVWDWHRI GLVUHSDLURULQFDSDEOHRIEHLQJPRYHGXQGHULWVRZQSRZHU >$@/$%(/('(TXLSPHQWPDWHULDOVRUSURGXFWVWRZKLFK KDYHEHHQDIIL[HGDODEHOVHDOV\PERORURWKHULGHQWLI\LQJ PDUNRIDQDWLRQDOO\UHFRJQL]HGWHVWLQJODERUDWRU\DSSURYHG DJHQF\RURWKHURUJDQL]DWLRQFRQFHUQHGZLWKSURGXFWHYDOXD WLRQWKDWPDLQWDLQVSHULRGLFLQVSHFWLRQRIWKHSURGXFWLRQRI WKHDERYHODEHOHGLWHPVDQGZKRVHODEHOLQJLQGLFDWHVHLWKHU WKDWWKHHTXLSPHQWPDWHULDORUSURGXFWPHHWVLGHQWLILHGVWDQ GDUGVRUKDVEHHQWHVWHGDQGIRXQGVXLWDEOHIRUDVSHFLILHG SXUSRVH /(7)252&&83$1&<RU/(77RSHUPLWSURYLGHRU RIIHUSRVVHVVLRQRURFFXSDQF\RIDGZHOOLQJGZHOOLQJXQLW URRPLQJXQLWEXLOGLQJSUHPLVHRUVWUXFWXUHE\DSHUVRQZKR LVRULVQRWWKHOHJDORZQHURIUHFRUGWKHUHRISXUVXDQWWRD ZULWWHQRUXQZULWWHQOHDVHDJUHHPHQWRUOLFHQVHRUSXUVXDQW WRDUHFRUGHGRUXQUHFRUGHGDJUHHPHQWRIFRQWUDFWIRUWKHVDOH RIODQG 1(*/(&77KHODFNRISURSHUPDLQWHQDQFHIRUDEXLOGLQJ RUVWUXFWXUH >$@2&&83$1&<7KHSXUSRVHIRU ZKLFK DEXLOGLQJRU SRUWLRQWKHUHRILVXWLOL]HGRURFFXSLHG 2&&83$17$Q\LQGLYLGXDOOLYLQJRUVOHHSLQJLQDEXLOG LQJRUKDYLQJSRVVHVVLRQRIDVSDFHZLWKLQDEXLOGLQJ 23(1$%/( $5($ 7KDW SDUW RI D ZLQGRZ VN\OLJKW RU GRRU ZKLFK LV DYDLODEOH IRU XQREVWUXFWHGYHQWLODWLRQDQG ZKLFKRSHQVGLUHFWO\WRWKHRXWGRRUV 23(5$725$Q\SHUVRQZKRKDVFKDUJHFDUHRUFRQWURORI DVWUXFWXUHRUSUHPLVHVWKDWLVOHWRURIIHUHGIRURFFXSDQF\ >$@2:1(5$Q\SHUVRQDJHQWRSHUDWRUILUPRUFRUSRUD WLRQ KDYLQJ OHJDO RU HTXLWDEOH LQWHUHVW LQ WKH SURSHUW\ RU UHFRUGHGLQWKHRIILFLDOUHFRUGVRIWKHVWDWHFRXQW\RUPXQLFL SDOLW\DVKROGLQJWLWOHWRWKHSURSHUW\RURWKHUZLVHKDYLQJ FRQWURORIWKHSURSHUW\LQFOXGLQJWKHJXDUGLDQRIWKHHVWDWHRI DQ\ VXFK SHUVRQ DQG WKH H[HFXWRU RU DGPLQLVWUDWRU RIWKH HVWDWHRIVXFKSHUVRQLIRUGHUHGWRWDNHSRVVHVVLRQRIUHDO SURSHUW\E\DFRXUW 3(5621 $Q LQGLYLGXDO FRUSRUDWLRQ SDUWQHUVKLS RU DQ\ RWKHUJURXSDFWLQJDVDXQLW 3(67 (/,0,1$7,21 7KH FRQWURO DQG HOLPLQDWLRQ RI LQVHFWVURGHQWVRURWKHUSHVWVE\HOLPLQDWLQJWKHLUKDUERUDJH SODFHVE\ UHPRYLQJ RUPDNLQJ LQDFFHVVLEOH PDWHULDOV WKDW VHUYHDVWKHLUIRRGRUZDWHUE\RWKHUDSSURYHGSHVWHOLPLQD WLRQPHWKRGV >$@35(0,6(6$ORWSORWRUSDUFHORIODQGHDVHPHQWRU SXEOLFZD\LQFOXGLQJDQ\VWUXFWXUHVWKHUHRQ >$@38%/,&:$<$Q\VWUHHWDOOH\RURWKHUSDUFHORIODQG WKDWLVRSHQWRWKHRXWVLGHDLUOHDGVWRDVWUHHWKDVEHHQ GHHGHGGHGLFDWHGRURWKHUZLVHSHUPDQHQWO\DSSURSULDWHGWR WKHSXEOLFIRUSXEOLFXVHDQGKDVDFOHDUZLGWKDQGKHLJKWRI QRWOHVVWKDQIHHWPP 5220,1*+286($EXLOGLQJDUUDQJHGRURFFXSLHGIRU ORGJLQJZLWK RU ZLWKRXW PHDOV IRUFRPSHQVDWLRQ DQG QRW RFFXSLHGDVDRQHRUWZRIDPLO\GZHOOLQJ 5220,1*81,7$Q\URRPRUJURXSRIURRPVIRUPLQJD VLQJOHKDELWDEOHXQLWRFFXSLHGRULQWHQGHGWREHRFFXSLHGIRU VOHHSLQJRUOLYLQJEXWQRWIRUFRRNLQJSXUSRVHV 58%%,6+&RPEXVWLEOHDQGQRQFRPEXVWLEOHZDVWHPDWHUL DOVH[FHSWJDUEDJHWKHWHUPVKDOOLQFOXGHWKHUHVLGXHIURP WKHEXUQLQJRIZRRGFRDOFRNHDQGRWKHUFRPEXVWLEOHPDWH ULDOV SDSHU UDJV FDUWRQV ER[HV ZRRG H[FHOVLRU UXEEHU OHDWKHUWUHHEUDQFKHV\DUGWULPPLQJVWLQFDQVPHWDOVPLQ HUDOPDWWHUJODVVFURFNHU\DQGGXVWDQGRWKHUVLPLODUPDWHUL DOV >%*@6/((3,1*81,7$URRPRUVSDFHLQZKLFKSHRSOH VOHHSZKLFKFDQDOVRLQFOXGHSHUPDQHQWSURYLVLRQVIRUOLY LQJHDWLQJDQGHLWKHUVDQLWDWLRQRUNLWFKHQIDFLOLWLHVEXWQRW ERWK6XFKURRPVDQGVSDFHVWKDWDUHDOVRSDUWRIDGZHOOLQJ XQLWDUHQRWVOHHSLQJXQLWV 675,&7/,$%,/,7<2))(16($QRIIHQVHLQZKLFKWKH SURVHFXWLRQLQDOHJDOSURFHHGLQJLV QRWUHTXLUHGWRSURYH FULPLQDOLQWHQWDVDSDUWRILWVFDVH,WLVHQRXJKWRSURYHWKDW WKHGHIHQGDQWHLWKHUGLGDQDFWZKLFKZDVSURKLELWHGRUIDLOHG WRGRDQDFWZKLFKWKHGHIHQGDQWZDVOHJDOO\UHTXLUHGWRGR >$@6758&785(7KDWZKLFKLVEXLOWRUFRQVWUXFWHG 7(1$17 $ SHUVRQ FRUSRUDWLRQ SDUWQHUVKLS RU JURXS ZKHWKHURUQRWWKHOHJDORZQHURIUHFRUGRFFXS\LQJDEXLOG LQJRUSRUWLRQWKHUHRIDVDXQLW 72,/(75220$URRPFRQWDLQLQJDZDWHUFORVHWRUXULQDO EXWQRWDEDWKWXERUVKRZHU 8/7,0$7('()250$7,217KHGHIRUPDWLRQDWZKLFK IDLOXUHRFFXUVDQGWKDWVKDOOEHGHHPHGWRRFFXULIWKHVXVWDLQ DEOH ORDG UHGXFHV WR SHUFHQW RU OHVV RI WKH PD[LPXP VWUHQJWK >0@9(17,/$7,217KHQDWXUDORUPHFKDQLFDOSURFHVVRI VXSSO\LQJFRQGLWLRQHGRUXQFRQGLWLRQHGDLUWRRUUHPRYLQJ VXFKDLUIURPDQ\VSDFH :25.0$1/,.(([HFXWHGLQDVNLOOHGPDQQHUHJJHQ HUDOO\SOXPEOHYHOVTXDUHLQOLQHXQGDPDJHGDQGZLWKRXW PDUULQJDGMDFHQWZRUN >=@<$5'$QRSHQVSDFHRQWKHVDPHORWZLWKDVWUXFWXUH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 Page: 23 Number: 1 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:23:09 PM (also see "Garbage." Garbage and Rubbish shall be taken to encompass both definitions herein.) ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 *(1(5$/5(48,5(0(176 User note: About this chapter: Chapter 3 is broad in scope and includes a variety of requirements for the maintenance of exterior property areas, as well as the interior and exterior elements of the structure, that are intended to maintain a minimum level of safety and sanitation for both the general public and the occupants of a structure, and to maintain a building’s structural and weather-resistance performance. Specifically, Chapter 3 contains criteria for the maintenance of building components; vacant structures and land; the safety, sanitation and appearance of the interior and exterior of structures and all exterior property areas; accessory structures; extermination of insects and rodents; access barri- ers to swimming pools, spas and hot tubs; vehicle storage and owner/occupant responsibilities. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPFRQGLWLRQVDQGWKHUHVSRQVLELOLWLHVRISHUVRQVIRU PDLQWHQDQFHRIVWUXFWXUHVHTXLSPHQWDQGH[WHULRUSURSHUW\ 5HVSRQVLELOLW\7KHRZQHURIWKHSUHPLVHVVKDOOPDLQ WDLQWKHVWUXFWXUHVDQGH[WHULRUSURSHUW\LQFRPSOLDQFHZLWK WKHVHUHTXLUHPHQWVH[FHSWDVRWKHUZLVHSURYLGHGIRULQWKLV FRGH$SHUVRQVKDOOQRWRFFXS\DVRZQHURFFXSDQWRUSHUPLW DQRWKHUSHUVRQWRRFFXS\SUHPLVHVWKDWDUHQRWLQDVDQLWDU\ DQGVDIHFRQGLWLRQDQGWKDWGRQRWFRPSO\ZLWKWKHUHTXLUH PHQWVRIWKLVFKDSWHU2FFXSDQWVRIDGZHOOLQJXQLWURRPLQJ XQLWRUKRXVHNHHSLQJXQLWDUHUHVSRQVLEOHIRUNHHSLQJLQD FOHDQVDQLWDU\DQGVDIHFRQGLWLRQWKDWSDUWRIWKHGZHOOLQJ XQLWURRPLQJ XQLWKRXVHNHHSLQJ XQLWRUSUHPLVHVWKH\ RFFXS\DQGFRQWURO 9DFDQWVWUXFWXUHVDQGODQG9DFDQWVWUXFWXUHVDQG SUHPLVHV WKHUHRI RU YDFDQW ODQG VKDOO EH PDLQWDLQHG LQ D FOHDQVDIHVHFXUHDQGVDQLWDU\FRQGLWLRQDVSURYLGHGKHUHLQ VRDVQRWWRFDXVHDEOLJKWLQJSUREOHPRUDGYHUVHO\DIIHFWWKH SXEOLFKHDOWKRUVDIHW\ 6(&7,21 (;7(5,253523(57<$5($6 6DQLWDWLRQ([WHULRUSURSHUW\DQGSUHPLVHVVKDOOEH PDLQWDLQHGLQDFOHDQVDIHDQGVDQLWDU\FRQGLWLRQ7KHRFFX SDQWVKDOONHHSWKDWSDUWRIWKHH[WHULRUSURSHUW\WKDWVXFK RFFXSDQWRFFXSLHVRUFRQWUROVLQDFOHDQDQGVDQLWDU\FRQGL WLRQ *UDGLQJDQGGUDLQDJH3UHPLVHVVKDOOEHJUDGHGDQG PDLQWDLQHGWRSUHYHQWWKHHURVLRQRIVRLODQGWRSUHYHQWWKH DFFXPXODWLRQRIVWDJQDQWZDWHUWKHUHRQRUZLWKLQDQ\VWUXF WXUHORFDWHGWKHUHRQ ([FHSWLRQ$SSURYHGUHWHQWLRQDUHDVDQGUHVHUYRLUV 6LGHZDONV DQG GULYHZD\V 6LGHZDONV ZDONZD\V VWDLUVGULYHZD\VSDUNLQJVSDFHVDQGVLPLODUDUHDVVKDOOEH NHSWLQDSURSHUVWDWHRIUHSDLUDQGPDLQWDLQHGIUHHIURPKD] DUGRXVFRQGLWLRQV :HHGV3UHPLVHVDQGH[WHULRUSURSHUW\VKDOOEHPDLQ WDLQHGIUHHIURPZHHGVRUSODQWJURZWKLQH[FHVVRI>-85,6 ',&7,2172,16(57+(,*+7,1,1&+(6@1R[LRXVZHHGVVKDOO EHSURKLELWHG:HHGVVKDOOEHGHILQHGDVDOOJUDVVHVDQQXDO SODQWVDQGYHJHWDWLRQRWKHUWKDQWUHHVRUVKUXEVSURYLGHG KRZHYHUWKLVWHUPVKDOOQRWLQFOXGHFXOWLYDWHGIORZHUVDQG JDUGHQV 8SRQIDLOXUHRIWKHRZQHURUDJHQWKDYLQJFKDUJHRID SURSHUW\WRFXWDQGGHVWUR\ZHHGVDIWHUVHUYLFHRIDQRWLFHRI YLRODWLRQWKH\VKDOOEHVXEMHFWWRSURVHFXWLRQLQDFFRUGDQFH ZLWK6HFWLRQDQGDVSUHVFULEHGE\WKHDXWKRULW\KDYLQJ MXULVGLFWLRQ8SRQIDLOXUHWRFRPSO\ZLWKWKHQRWLFHRIYLROD WLRQDQ\GXO\DXWKRUL]HGHPSOR\HHRIWKHMXULVGLFWLRQRUFRQ WUDFWRUKLUHGE\WKHMXULVGLFWLRQVKDOOEHDXWKRUL]HGWRHQWHU XSRQWKHSURSHUW\LQYLRODWLRQDQGFXWDQGGHVWUR\WKHZHHGV JURZLQJWKHUHRQDQGWKHFRVWVRIVXFKUHPRYDOVKDOOEHSDLG E\WKHRZQHURUDJHQWUHVSRQVLEOHIRUWKHSURSHUW\ 5RGHQWKDUERUDJH6WUXFWXUHVDQGH[WHULRUSURSHUW\ VKDOO EH NHSW IUHH IURP URGHQW KDUERUDJH DQGLQIHVWDWLRQ :KHUH URGHQWVDUHIRXQG WKH\ VKDOOEHSURPSWO\H[WHUPL QDWHG E\DSSURYHG SURFHVVHV WKDW ZLOO QRW EH LQMXULRXV WR KXPDQ KHDOWK $IWHU SHVW HOLPLQDWLRQ SURSHU SUHFDXWLRQV VKDOOEHWDNHQWRHOLPLQDWHURGHQWKDUERUDJHDQGSUHYHQWUHLQ IHVWDWLRQ ([KDXVWYHQWV3LSHVGXFWVFRQGXFWRUVIDQVRUEORZ HUVVKDOOQRWGLVFKDUJHJDVHVVWHDPYDSRUKRWDLUJUHDVH VPRNHRGRUVRURWKHUJDVHRXVRUSDUWLFXODWHZDVWHVGLUHFWO\ RQDEXWWLQJRUDGMDFHQWSXEOLFRUSULYDWHSURSHUW\RUWKDWRI DQRWKHUWHQDQW $FFHVVRU\VWUXFWXUHV$FFHVVRU\VWUXFWXUHVLQFOXGLQJ GHWDFKHG JDUDJHV IHQFHV DQG ZDOOV VKDOO EH PDLQWDLQHG VWUXFWXUDOO\VRXQGDQGLQJRRGUHSDLU 0RWRUYHKLFOHV([FHSWDVSURYLGHGIRULQRWKHUUHJXOD WLRQVLQRSHUDWLYHRUXQOLFHQVHGPRWRUYHKLFOHVVKDOOQRWEH SDUNHGNHSWRUVWRUHGRQDQ\SUHPLVHVDQGYHKLFOHVVKDOOQRW DWDQ\WLPHEHLQDVWDWHRIPDMRUGLVDVVHPEO\GLVUHSDLURULQ WKHSURFHVVRIEHLQJVWULSSHGRUGLVPDQWOHG3DLQWLQJRIYHKL FOHVLVSURKLELWHGXQOHVVFRQGXFWHGLQVLGHDQDSSURYHGVSUD\ ERRWK ([FHSWLRQ$YHKLFOHRIDQ\W\SHLVSHUPLWWHGWRXQGHUJR PDMRURYHUKDXOLQFOXGLQJERG\ZRUNSURYLGHGWKDWVXFK ZRUNLVSHUIRUPHGLQVLGHDVWUXFWXUHRUVLPLODUO\HQFORVHG DUHDGHVLJQHGDQGDSSURYHGIRUVXFKSXUSRVHV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 Page: 24 Number: 1 Author: MPoehlman Date: 12/23/2019 2:25:00 PM Number: 2 Author: MPoehlman Subject: Inserted Text Date: 1/14/2020 3:14:39 PM ...as provided in Section 925.02 of the city code. Number: 3 Author: MPoehlman Date: 12/23/2019 2:26:53 PM If we need to Reference the city code we will be using here, it is City Code 925.06 *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 'HIDFHPHQWRISURSHUW\$SHUVRQVKDOOQRWZLOOIXOO\ RUZDQWRQO\GDPDJHPXWLODWHRUGHIDFHDQ\H[WHULRUVXUIDFH RIDQ\VWUXFWXUHRUEXLOGLQJRQDQ\SULYDWHRUSXEOLFSURSHUW\ E\SODFLQJWKHUHRQDQ\PDUNLQJFDUYLQJRUJUDIILWL ,WVKDOOEHWKHUHVSRQVLELOLW\RIWKHRZQHUWRUHVWRUHVDLG VXUIDFHWRDQDSSURYHGVWDWHRIPDLQWHQDQFHDQGUHSDLU 6(&7,21 6:,00,1*322/663$6$1'+2778%6 6ZLPPLQJ SRROV 6ZLPPLQJ SRROV VKDOO EH PDLQ WDLQHGLQDFOHDQDQGVDQLWDU\FRQGLWLRQDQGLQJRRGUHSDLU (QFORVXUHV3ULYDWHVZLPPLQJSRROVKRWWXEVDQG VSDV FRQWDLQLQJ ZDWHU PRUH WKDQ LQFKHV PP LQ GHSWKVKDOOEHFRPSOHWHO\VXUURXQGHGE\DIHQFHRUEDUULHU QRWOHVVWKDQLQFKHVPPLQKHLJKWDERYHWKHILQ LVKHGJURXQGOHYHOPHDVXUHGRQWKHVLGHRIWKHEDUULHUDZD\ IURPWKHSRRO*DWHVDQGGRRUVLQVXFKEDUULHUVVKDOOEHVHOI FORVLQJDQGVHOIODWFKLQJ:KHUHWKHVHOIODWFKLQJGHYLFHLV OHVVWKDQLQFKHVPPDERYHWKHERWWRPRIWKHJDWH WKHUHOHDVHPHFKDQLVPVKDOOEHORFDWHGRQWKHSRROVLGHRIWKH JDWH6HOIFORVLQJDQGVHOIODWFKLQJJDWHVVKDOOEHPDLQWDLQHG VXFK WKDW WKH JDWH ZLOO SRVLWLYHO\ FORVH DQG ODWFK ZKHQ UHOHDVHGIURPDQRSHQSRVLWLRQRILQFKHVPPIURPWKH JDWHSRVW$QH[LVWLQJSRROHQFORVXUHVKDOOQRWEHUHPRYHG UHSODFHGRUFKDQJHGLQDPDQQHUWKDWUHGXFHVLWVHIIHFWLYHQHVV DVDVDIHW\EDUULHU ([FHSWLRQ6SDVRUKRWWXEVZLWKDVDIHW\FRYHUWKDWFRP SOLHVZLWK$670)VKDOOEHH[HPSWIURPWKHSURYL VLRQVRIWKLVVHFWLRQ 6(&7,21 (;7(5,256758&785( *HQHUDO 7KH H[WHULRURID VWUXFWXUH VKDOO EH PDLQ WDLQHGLQJRRGUHSDLUVWUXFWXUDOO\VRXQGDQGVDQLWDU\VRDVQRW WRSRVHDWKUHDWWRWKHSXEOLFKHDOWKVDIHW\RUZHOIDUH 8QVDIH FRQGLWLRQV 7KH IROORZLQJ FRQGLWLRQV VKDOO EH GHWHUPLQHG DV XQVDIH DQG VKDOO EH UHSDLUHG RU UHSODFHGWRFRPSO\ZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH RUWKH,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ&RGHDVUHTXLUHGIRU H[LVWLQJEXLOGLQJV 7KHQRPLQDOVWUHQJWKRIDQ\VWUXFWXUDOPHPEHULV H[FHHGHGE\QRPLQDOORDGVWKHORDGHIIHFWVRUWKH UHTXLUHGVWUHQJWK 7KHDQFKRUDJHRIWKHIORRURUURRIWRZDOOVRUFRO XPQVDQGRIZDOOVDQGFROXPQVWRIRXQGDWLRQVLV QRWFDSDEOHRIUHVLVWLQJDOOQRPLQDOORDGVRUORDG HIIHFWV 6WUXFWXUHV RU FRPSRQHQWV WKHUHRI WKDW KDYH UHDFKHGWKHLUOLPLWVWDWH 6LGLQJ DQG PDVRQU\ MRLQWV LQFOXGLQJ MRLQWV EHWZHHQWKHEXLOGLQJHQYHORSHDQGWKHSHULPHWHU RI ZLQGRZV GRRUV DQG VN\OLJKWV DUH QRW PDLQ WDLQHGZHDWKHUUHVLVWDQWRUZDWHUWLJKW 6WUXFWXUDOPHPEHUVWKDWKDYHHYLGHQFHRIGHWHULR UDWLRQRUWKDWDUHQRWFDSDEOHRIVDIHO\VXSSRUWLQJ DOOQRPLQDOORDGVDQGORDGHIIHFWV )RXQGDWLRQV\VWHPVWKDWDUHQRWILUPO\VXSSRUWHG E\ IRRWLQJV DUH QRW SOXPE DQG IUHH IURP RSHQ FUDFNVDQGEUHDNVDUHQRWSURSHUO\DQFKRUHGRU DUH QRW FDSDEOH RI VXSSRUWLQJ DOO QRPLQDO ORDGV DQGUHVLVWLQJDOOORDGHIIHFWV ([WHULRUZDOOVWKDWDUHQRWDQFKRUHGWRVXSSRUWLQJ DQGVXSSRUWHGHOHPHQWVRUDUHQRWSOXPEDQGIUHH RI KROHV FUDFNV RU EUHDNV DQG ORRVH RU URWWLQJ PDWHULDOV DUH QRW SURSHUO\ DQFKRUHG RU DUH QRW FDSDEOHRIVXSSRUWLQJDOOQRPLQDOORDGVDQGUHVLVW LQJDOOORDGHIIHFWV 5RRILQJRUURRILQJFRPSRQHQWVWKDWKDYHGHIHFWV WKDW DGPLW UDLQ URRI VXUIDFHV ZLWK LQDGHTXDWH GUDLQDJHRUDQ\SRUWLRQRIWKHURRIIUDPLQJWKDWLV QRW LQ JRRG UHSDLU ZLWK VLJQV RIGHWHULRUDWLRQ IDWLJXHRUZLWKRXWSURSHUDQFKRUDJHDQGLQFDSDEOH RIVXSSRUWLQJDOOQRPLQDOORDGVDQGUHVLVWLQJDOO ORDGHIIHFWV )ORRULQJ DQG IORRULQJ FRPSRQHQWV ZLWK GHIHFWV WKDWDIIHFWVHUYLFHDELOLW\RUIORRULQJFRPSRQHQWV WKDWVKRZVLJQVRIGHWHULRUDWLRQRUIDWLJXHDUHQRW SURSHUO\DQFKRUHGRUDUHLQFDSDEOHRIVXSSRUWLQJ DOOQRPLQDOORDGVDQGUHVLVWLQJDOOORDGHIIHFWV 9HQHHUFRUQLFHVEHOWFRXUVHVFRUEHOVWULPZDOO IDFLQJVDQGVLPLODUGHFRUDWLYHIHDWXUHVQRWSURS HUO\DQFKRUHGRUWKDWDUHDQFKRUHGZLWKFRQQHF WLRQVQRWFDSDEOHRIVXSSRUWLQJDOOQRPLQDOORDGV DQGUHVLVWLQJDOOORDGHIIHFWV 2YHUKDQJH[WHQVLRQVRUSURMHFWLRQVLQFOXGLQJEXW QRWOLPLWHGWRWUDVKFKXWHVFDQRSLHVPDUTXHHV VLJQV DZQLQJV ILUH HVFDSHV VWDQGSLSHV DQG H[KDXVWGXFWVQRWSURSHUO\DQFKRUHGRUWKDWDUH DQFKRUHGZLWKFRQQHFWLRQVQRWFDSDEOHRIVXSSRUW LQJDOOQRPLQDOORDGVDQGUHVLVWLQJDOOORDGHIIHFWV ([WHULRUVWDLUVGHFNVSRUFKHVEDOFRQLHVDQGDOO VLPLODUDSSXUWHQDQFHVDWWDFKHGWKHUHWRLQFOXGLQJ JXDUGVDQGKDQGUDLOVDUHQRWVWUXFWXUDOO\VRXQG QRWSURSHUO\DQFKRUHGRUWKDWDUHDQFKRUHGZLWK FRQQHFWLRQVQRWFDSDEOHRIVXSSRUWLQJDOOQRPLQDO ORDGVDQGUHVLVWLQJDOOORDGHIIHFWV &KLPQH\VFRROLQJWRZHUVVPRNHVWDFNVDQGVLPL ODU DSSXUWHQDQFHV QRW VWUXFWXUDOO\ VRXQG RU QRW SURSHUO\DQFKRUHGRUWKDWDUHDQFKRUHGZLWKFRQ QHFWLRQV QRW FDSDEOH RI VXSSRUWLQJ DOO QRPLQDO ORDGVDQGUHVLVWLQJDOOORDGHIIHFWV ([FHSWLRQV :KHUH VXEVWDQWLDWHG RWKHUZLVH E\ DQDSSURYHG PHWKRG 'HPROLWLRQRIXQVDIHFRQGLWLRQVVKDOOEHSHUPLW WHGZKHUHDSSURYHGE\WKHFRGHRIILFLDO 3URWHFWLYHWUHDWPHQW([WHULRUVXUIDFHVLQFOXGLQJEXW QRW OLPLWHG WR GRRUV GRRU DQG ZLQGRZ IUDPHV FRUQLFHV SRUFKHV WULP EDOFRQLHV GHFNVDQGIHQFHV VKDOO EH PDLQ WDLQHGLQJRRGFRQGLWLRQ([WHULRUZRRGVXUIDFHVRWKHUWKDQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 Page: 25 Number: 1 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:28:42 PM ...within 48 hours or as designated by the Code Official. *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( GHFD\UHVLVWDQWZRRGVVKDOOEHSURWHFWHGIURPWKHHOHPHQWV DQGGHFD\E\SDLQWLQJRURWKHUSURWHFWLYHFRYHULQJRUWUHDW PHQW3HHOLQJIODNLQJDQGFKLSSHGSDLQWVKDOOEHHOLPLQDWHG DQGVXUIDFHVUHSDLQWHG6LGLQJDQGPDVRQU\MRLQWVDVZHOODV WKRVH EHWZHHQ WKH EXLOGLQJ HQYHORSH DQG WKH SHULPHWHU RI ZLQGRZVGRRUVDQGVN\OLJKWVVKDOOEHPDLQWDLQHGZHDWKHU UHVLVWDQWDQGZDWHUWLJKW0HWDOVXUIDFHVVXEMHFWWRUXVWRUFRU URVLRQVKDOOEHFRDWHGWRLQKLELWVXFKUXVWDQGFRUURVLRQDQG VXUIDFHVZLWKUXVWRUFRUURVLRQVKDOOEHVWDELOL]HGDQGFRDWHG WRLQKLELWIXWXUHUXVWDQGFRUURVLRQ2[LGDWLRQVWDLQVVKDOOEH UHPRYHGIURPH[WHULRUVXUIDFHV6XUIDFHVGHVLJQHGIRUVWDELOL ]DWLRQE\R[LGDWLRQDUHH[HPSWIURPWKLVUHTXLUHPHQW >)@ 3UHPLVHV LGHQWLILFDWLRQ %XLOGLQJV VKDOO KDYH DSSURYHGDGGUHVVQXPEHUVSODFHGLQDSRVLWLRQWREHSODLQO\ OHJLEOHDQGYLVLEOHIURPWKHVWUHHWRUURDGIURQWLQJWKHSURS HUW\ 7KHVH QXPEHUV VKDOO FRQWUDVW ZLWK WKHLU EDFNJURXQG $GGUHVVQXPEHUVVKDOOEH$UDELFQXPHUDOVRUDOSKDEHWOHW WHUV1XPEHUVVKDOOEHQRWOHVVWKDQLQFKHVPPLQ KHLJKWZLWKDPLQLPXPVWURNHZLGWKRILQFKPP 6WUXFWXUDO PHPEHUV 6WUXFWXUDO PHPEHUV VKDOO EH PDLQWDLQHGIUHHIURPGHWHULRUDWLRQDQGVKDOOEHFDSDEOHRI VDIHO\VXSSRUWLQJWKHLPSRVHGGHDGDQGOLYHORDGV )RXQGDWLRQZDOOV)RXQGDWLRQZDOOV VKDOO EHPDLQ WDLQHGSOXPEDQGIUHHIURPRSHQFUDFNVDQGEUHDNVDQGVKDOO EHNHSWLQVXFKFRQGLWLRQVRDVWRSUHYHQWWKHHQWU\RIURGHQWV DQGRWKHUSHVWV ([WHULRUZDOOV([WHULRUZDOOVVKDOOEHIUHHIURPKROHV EUHDNVDQGORRVHRUURWWLQJPDWHULDOVDQGPDLQWDLQHGZHDWK HUSURRIDQGSURSHUO\VXUIDFHFRDWHGZKHUHUHTXLUHGWRSUH YHQWGHWHULRUDWLRQ 5RRIVDQGGUDLQDJH7KHURRIDQGIODVKLQJVKDOOEH VRXQGWLJKWDQGQRWKDYHGHIHFWVWKDWDGPLWUDLQ5RRIGUDLQ DJHVKDOOEHDGHTXDWHWRSUHYHQWGDPSQHVVRUGHWHULRUDWLRQLQ WKHZDOOVRULQWHULRUSRUWLRQRIWKHVWUXFWXUH5RRIGUDLQVJXW WHUVDQGGRZQVSRXWVVKDOOEHPDLQWDLQHGLQJRRGUHSDLUDQG IUHHIURPREVWUXFWLRQV5RRIZDWHUVKDOOQRWEHGLVFKDUJHGLQ DPDQQHUWKDWFUHDWHVDSXEOLFQXLVDQFH 'HFRUDWLYHIHDWXUHV&RUQLFHVEHOWFRXUVHVFRUEHOV WHUUDFRWWDWULPZDOOIDFLQJVDQGVLPLODUGHFRUDWLYHIHDWXUHV VKDOOEHPDLQWDLQHGLQJRRGUHSDLUZLWKSURSHUDQFKRUDJHDQG LQDVDIHFRQGLWLRQ 2YHUKDQJH[WHQVLRQV2YHUKDQJH[WHQVLRQVLQFOXGLQJ EXWQRWOLPLWHGWRFDQRSLHVPDUTXHHVVLJQVPHWDODZQLQJV ILUHHVFDSHVVWDQGSLSHVDQGH[KDXVWGXFWVVKDOOEHPDLQWDLQHG LQJRRGUHSDLUDQGEHSURSHUO\DQFKRUHGVRDVWREHNHSWLQD VRXQG FRQGLWLRQ :KHUH UHTXLUHG DOO H[SRVHG VXUIDFHV RI PHWDO RU ZRRG VKDOO EH SURWHFWHG IURP WKH HOHPHQWV DQG DJDLQVWGHFD\RUUXVWE\SHULRGLFDSSOLFDWLRQRIZHDWKHUFRDW LQJPDWHULDOVVXFKDVSDLQWRUVLPLODUVXUIDFHWUHDWPHQW 6WDLUZD\V GHFNV SRUFKHV DQG EDOFRQLHV(YHU\ H[WHULRUVWDLUZD\GHFNSRUFKDQGEDOFRQ\DQGDOODSSXUWH QDQFHV DWWDFKHG WKHUHWR VKDOO EH PDLQWDLQHG VWUXFWXUDOO\ VRXQGLQJRRGUHSDLUZLWKSURSHUDQFKRUDJHDQGFDSDEOHRI VXSSRUWLQJWKHLPSRVHGORDGV &KLPQH\VDQGWRZHUV&KLPQH\VFRROLQJWRZHUV VPRNHVWDFNVDQGVLPLODUDSSXUWHQDQFHVVKDOOEHPDLQWDLQHG VWUXFWXUDOO\VDIHDQGVRXQGDQGLQJRRGUHSDLU([SRVHGVXU IDFHVRIPHWDORUZRRGVKDOOEHSURWHFWHGIURPWKHHOHPHQWV DQGDJDLQVWGHFD\RUUXVWE\SHULRGLFDSSOLFDWLRQRIZHDWKHU FRDWLQJPDWHULDOVVXFKDVSDLQWRUVLPLODUVXUIDFHWUHDWPHQW +DQGUDLOV DQG JXDUGV (YHU\ KDQGUDLO DQGJXDUG VKDOOEHILUPO\IDVWHQHGDQGFDSDEOHRIVXSSRUWLQJQRUPDOO\ LPSRVHGORDGVDQGVKDOOEHPDLQWDLQHGLQJRRGFRQGLWLRQ :LQGRZVN\OLJKWDQGGRRUIUDPHV(YHU\ZLQGRZ VN\OLJKWGRRUDQGIUDPHVKDOOEHNHSWLQVRXQGFRQGLWLRQ JRRGUHSDLUDQGZHDWKHUWLJKW *OD]LQJ*OD]LQJPDWHULDOVVKDOOEHPDLQWDLQHG IUHHIURPFUDFNVDQGKROHV 2SHQDEOHZLQGRZV(YHU\ZLQGRZRWKHUWKDQD IL[HG ZLQGRZ VKDOO EH HDVLO\ RSHQDEOH DQG FDSDEOH RI EHLQJKHOGLQSRVLWLRQE\ZLQGRZKDUGZDUH ,QVHFW VFUHHQV 'XULQJ WKH SHULRG IURP>'$7(@WR >'$7(@ HYHU\ GRRU ZLQGRZ DQG RWKHU RXWVLGH RSHQLQJ UHTXLUHGIRUYHQWLODWLRQRIKDELWDEOHURRPVIRRGSUHSDUDWLRQ DUHDVIRRGVHUYLFHDUHDVRUDQ\DUHDVZKHUHSURGXFWVWREH LQFOXGHGRUXWLOL]HGLQIRRGIRUKXPDQFRQVXPSWLRQDUHSUR FHVVHGPDQXIDFWXUHGSDFNDJHGRUVWRUHGVKDOOEHVXSSOLHG ZLWKDSSURYHGWLJKWO\ILWWLQJVFUHHQVRIPLQLPXPPHVK SHULQFKPHVKSHUPPDQGHYHU\VFUHHQGRRUXVHGIRU LQVHFWFRQWUROVKDOOKDYHDVHOIFORVLQJGHYLFHLQJRRGZRUN LQJFRQGLWLRQ ([FHSWLRQ 6FUHHQV VKDOO QRW EH UHTXLUHG ZKHUH RWKHU DSSURYHGPHDQVVXFKDVDLUFXUWDLQVRULQVHFWUHSHOOHQW IDQVDUHHPSOR\HG 'RRUV([WHULRUGRRUVGRRUDVVHPEOLHVRSHUDWRUV\V WHPVLISURYLGHGDQGKDUGZDUHVKDOOEHPDLQWDLQHGLQJRRG FRQGLWLRQ/RFNVDWDOOHQWUDQFHVWRGZHOOLQJXQLWVDQGVOHHS LQJXQLWVVKDOOWLJKWO\VHFXUHWKHGRRU/RFNVRQPHDQVRI HJUHVVGRRUVVKDOOEHLQDFFRUGDQFHZLWK6HFWLRQ %DVHPHQW KDWFKZD\V (YHU\EDVHPHQWKDWFKZD\ VKDOOEHPDLQWDLQHGWRSUHYHQWWKHHQWUDQFHRIURGHQWVUDLQ DQGVXUIDFHGUDLQDJHZDWHU *XDUGV IRU EDVHPHQW ZLQGRZV (YHU\EDVHPHQW ZLQGRZWKDWLVRSHQDEOHVKDOOEHVXSSOLHGZLWKURGHQWVKLHOGV VWRUPZLQGRZVRURWKHUDSSURYHGSURWHFWLRQDJDLQVWWKHHQWU\ RIURGHQWV %XLOGLQJVHFXULW\'RRUVZLQGRZVRUKDWFKZD\VIRU GZHOOLQJXQLWVURRPXQLWVRUKRXVHNHHSLQJXQLWVVKDOOEHSUR YLGHGZLWKGHYLFHVGHVLJQHGWRSURYLGHVHFXULW\IRUWKHRFFX SDQWVDQGSURSHUW\ZLWKLQ 'RRUV 'RRUV SURYLGLQJ DFFHVV WR DGZHOOLQJ XQLWURRPLQJ XQLWRUKRXVHNHHSLQJ XQLW WKDW LV UHQWHG OHDVHG RU OHW VKDOO EH HTXLSSHG ZLWK D GHDGEROW ORFN GHVLJQHGWREHUHDGLO\RSHQDEOHIURPWKHVLGHIURPZKLFK HJUHVVLVWREHPDGHZLWKRXWWKHQHHGIRUNH\VVSHFLDO NQRZOHGJHRUHIIRUWDQGVKDOOKDYHDPLQLPXPORFNWKURZ RILQFKPP6XFKGHDGEROWORFNVVKDOOEHLQVWDOOHG DFFRUGLQJWRWKHPDQXIDFWXUHU¶VVSHFLILFDWLRQVDQGPDLQ WDLQHGLQJRRGZRUNLQJRUGHU)RUWKHSXUSRVHRIWKLVVHF WLRQDVOLGLQJEROWVKDOOQRWEHFRQVLGHUHGDQDFFHSWDEOH GHDGEROWORFN :LQGRZV2SHUDEOHZLQGRZVORFDWHGLQZKROH RULQSDUWZLWKLQIHHWPPDERYHJURXQGOHYHORUD Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 Page: 26 Number: 1 Author: MPoehlman Subject: Inserted Text Date: 1/15/2020 10:19:18 AM ...if on more than 20% of one side of any surface or building. Number: 2 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:31:50 PM 304.14 Insect screens. Every door... *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( ZDONLQJVXUIDFHEHORZWKDWSURYLGHDFFHVVWRDGZHOOLQJ XQLWURRPLQJ XQLWRUKRXVHNHHSLQJ XQLW WKDW LV UHQWHG OHDVHGRUOHWVKDOOEHHTXLSSHGZLWKDZLQGRZVDVKORFNLQJ GHYLFH %DVHPHQWKDWFKZD\V%DVHPHQWKDWFKZD\VWKDW SURYLGHDFFHVVWRDGZHOOLQJXQLWURRPLQJXQLWRUKRXVH NHHSLQJXQLWWKDWLVUHQWHGOHDVHGRUOHWVKDOOEHHTXLSSHG ZLWKGHYLFHVWKDWVHFXUHWKHXQLWVIURPXQDXWKRUL]HGHQWU\ *DWHV([WHULRUJDWHVJDWHDVVHPEOLHVRSHUDWRUV\V WHPVLISURYLGHGDQGKDUGZDUHVKDOOEHPDLQWDLQHGLQJRRG FRQGLWLRQ /DWFKHV DW DOO HQWUDQFHV VKDOO WLJKWO\ VHFXUH WKH JDWHV 6(&7,21 ,17(5,256758&785( *HQHUDO 7KH LQWHULRU RI D VWUXFWXUH DQG HTXLSPHQW WKHUHLQVKDOOEHPDLQWDLQHGLQJRRGUHSDLUVWUXFWXUDOO\VRXQG DQGLQDVDQLWDU\FRQGLWLRQ2FFXSDQWVVKDOONHHSWKDWSDUWRI WKHVWUXFWXUHWKDWWKH\RFFXS\RUFRQWUROLQDFOHDQDQGVDQL WDU\FRQGLWLRQ(YHU\RZQHURIDVWUXFWXUHFRQWDLQLQJDURRP LQJKRXVHKRXVHNHHSLQJXQLWVDKRWHODGRUPLWRU\WZRRU PRUHGZHOOLQJXQLWVRUWZRRUPRUHQRQUHVLGHQWLDORFFXSDQ FLHVVKDOOPDLQWDLQLQDFOHDQDQGVDQLWDU\FRQGLWLRQWKH VKDUHGRUSXEOLFDUHDVRIWKHVWUXFWXUHDQGH[WHULRUSURSHUW\ 8QVDIH FRQGLWLRQV 7KH IROORZLQJ FRQGLWLRQV VKDOO EH GHWHUPLQHG DV XQVDIH DQG VKDOO EH UHSDLUHG RU UHSODFHGWRFRPSO\ZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH RUWKH,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ&RGHDVUHTXLUHGIRU H[LVWLQJEXLOGLQJV 7KHQRPLQDOVWUHQJWKRIDQ\VWUXFWXUDOPHPEHULV H[FHHGHGE\QRPLQDOORDGVWKHORDGHIIHFWVRUWKH UHTXLUHGVWUHQJWK 7KHDQFKRUDJHRIWKHIORRURUURRIWRZDOOVRUFRO XPQVDQGRIZDOOVDQGFROXPQVWRIRXQGDWLRQVLV QRWFDSDEOHRIUHVLVWLQJDOOQRPLQDOORDGVRUORDG HIIHFWV 6WUXFWXUHVRUFRPSRQHQWVWKHUHRIWKDWKDYHUHDFKHG WKHLUOLPLWVWDWH 6WUXFWXUDO PHPEHUV DUH LQFDSDEOH RI VXSSRUWLQJ QRPLQDOORDGVDQGORDGHIIHFWV 6WDLUVODQGLQJVEDOFRQLHVDQGDOOVLPLODUZDONLQJ VXUIDFHV LQFOXGLQJJXDUGV DQG KDQGUDLOV DUH QRW VWUXFWXUDOO\ VRXQG QRW SURSHUO\DQFKRUHGRU DUH DQFKRUHGZLWKFRQQHFWLRQVQRWFDSDEOHRIVXSSRUW LQJDOOQRPLQDOORDGVDQGUHVLVWLQJDOOORDGHIIHFWV )RXQGDWLRQV\VWHPVWKDWDUHQRWILUPO\VXSSRUWHGE\ IRRWLQJVDUHQRWSOXPEDQGIUHHIURPRSHQFUDFNV DQG EUHDNV DUH QRW SURSHUO\DQFKRUHGRUDUHQRW FDSDEOHRIVXSSRUWLQJDOOQRPLQDOORDGVDQGUHVLVWLQJ DOOORDGHIIHFWV ([FHSWLRQV :KHUH VXEVWDQWLDWHG RWKHUZLVH E\ DQDSSURYHG PHWKRG 'HPROLWLRQRIXQVDIHFRQGLWLRQVVKDOOEHSHUPLW WHGZKHUHDSSURYHGE\WKHFRGHRIILFLDO 6WUXFWXUDO PHPEHUV6WUXFWXUDO PHPEHUV VKDOO EH PDLQWDLQHGVWUXFWXUDOO\VRXQGDQGEHFDSDEOHRIVXSSRUWLQJ WKHLPSRVHGORDGV ,QWHULRU VXUIDFHV ,QWHULRU VXUIDFHV LQFOXGLQJ ZLQ GRZVDQGGRRUVVKDOOEHPDLQWDLQHGLQJRRGFOHDQDQGVDQL WDU\ FRQGLWLRQ 3HHOLQJ FKLSSLQJ IODNLQJ RU DEUDGHG SDLQW VKDOOEHUHSDLUHGUHPRYHGRUFRYHUHG&UDFNHGRUORRVHSODV WHU GHFD\HG ZRRG DQG RWKHU GHIHFWLYH VXUIDFH FRQGLWLRQV VKDOOEHFRUUHFWHG 6WDLUVDQGZDONLQJVXUIDFHV(YHU\VWDLUUDPSODQG LQJEDOFRQ\SRUFKGHFNRURWKHUZDONLQJVXUIDFHVKDOOEH PDLQWDLQHGLQVRXQGFRQGLWLRQDQGJRRGUHSDLU +DQGUDLOVDQGJXDUGV(YHU\KDQGUDLODQGJXDUGVKDOO EH ILUPO\ IDVWHQHG DQG FDSDEOH RI VXSSRUWLQJ QRUPDOO\ LPSRVHGORDGVDQGVKDOOEHPDLQWDLQHGLQJRRGFRQGLWLRQ ,QWHULRUGRRUV(YHU\LQWHULRUGRRUVKDOOILWUHDVRQDEO\ ZHOOZLWKLQLWVIUDPHDQGVKDOOEHFDSDEOHRIEHLQJRSHQHG DQGFORVHGE\EHLQJSURSHUO\DQGVHFXUHO\DWWDFKHGWRMDPEV KHDGHUV RU WUDFNV DV LQWHQGHG E\ WKH PDQXIDFWXUHU RI WKH DWWDFKPHQWKDUGZDUH 6(&7,21 &20321(176(59,&($%,/,7< *HQHUDO7KHFRPSRQHQWVRIDVWUXFWXUHDQGHTXLSPHQW WKHUHLQVKDOOEHPDLQWDLQHGLQJRRGUHSDLUVWUXFWXUDOO\VRXQG DQGLQDVDQLWDU\FRQGLWLRQ 8QVDIHFRQGLWLRQV:KHUHDQ\RIWKHIROORZLQJ FRQGLWLRQVFDXVHWKHFRPSRQHQWRUV\VWHPWREHEH\RQGLWV OLPLWVWDWHWKHFRPSRQHQWRUV\VWHPVKDOOEHGHWHUPLQHG DVXQVDIHDQGVKDOOEHUHSDLUHGRUUHSODFHGWRFRPSO\ZLWK WKH,QWHUQDWLRQDO%XLOGLQJ&RGHRUWKH,QWHUQDWLRQDO([LVW LQJ%XLOGLQJ&RGHDVUHTXLUHGIRUH[LVWLQJEXLOGLQJV 6RLOVWKDWKDYHEHHQVXEMHFWHGWRDQ\RIWKHIROORZ LQJFRQGLWLRQV &ROODSVHRIIRRWLQJRUIRXQGDWLRQV\VWHP 'DPDJHWRIRRWLQJIRXQGDWLRQFRQFUHWHRU RWKHUVWUXFWXUDOHOHPHQWGXHWRVRLOH[SDQ VLRQ $GYHUVH HIIHFWV WR WKH GHVLJQ VWUHQJWK RI IRRWLQJIRXQGDWLRQFRQFUHWHRURWKHUVWUXF WXUDO HOHPHQW GXH WR D FKHPLFDO UHDFWLRQ IURPWKHVRLO ,QDGHTXDWHVRLODVGHWHUPLQHGE\DJHRWHFK QLFDOLQYHVWLJDWLRQ :KHUHWKHDOORZDEOHEHDULQJFDSDFLW\RIWKH VRLOLVLQGRXEW $GYHUVHHIIHFWVWRWKHIRRWLQJIRXQGDWLRQ FRQFUHWHRURWKHUVWUXFWXUDOHOHPHQWGXHWR WKHJURXQGZDWHUWDEOH &RQFUHWHWKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIRO ORZLQJFRQGLWLRQV 'HWHULRUDWLRQ 8OWLPDWHGHIRUPDWLRQ )UDFWXUHV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( )LVVXUHV 6SDOOLQJ ([SRVHGUHLQIRUFHPHQW 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV $OXPLQXPWKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIRO ORZLQJFRQGLWLRQV 'HWHULRUDWLRQ &RUURVLRQ (ODVWLFGHIRUPDWLRQ 8OWLPDWHGHIRUPDWLRQ 6WUHVVRUVWUDLQFUDFNV -RLQWIDWLJXH 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV 0DVRQU\WKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIRO ORZLQJFRQGLWLRQV 'HWHULRUDWLRQ 8OWLPDWHGHIRUPDWLRQ )UDFWXUHVLQPDVRQU\RUPRUWDUMRLQWV )LVVXUHVLQPDVRQU\RUPRUWDUMRLQWV 6SDOOLQJ ([SRVHGUHLQIRUFHPHQW 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV 6WHHOWKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIROORZLQJ FRQGLWLRQV 'HWHULRUDWLRQ (ODVWLFGHIRUPDWLRQ 8OWLPDWHGHIRUPDWLRQ 0HWDOIDWLJXH 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV :RRGWKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIROORZ LQJFRQGLWLRQV 8OWLPDWHGHIRUPDWLRQ 'HWHULRUDWLRQ 'DPDJHIURPLQVHFWVURGHQWVDQGRWKHU YHUPLQ )LUHGDPDJHEH\RQGFKDUULQJ 6LJQLILFDQWVSOLWVDQGFKHFNV +RUL]RQWDOVKHDUFUDFNV 9HUWLFDOVKHDUFUDFNV ,QDGHTXDWHVXSSRUW 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV ([FHVVLYHFXWWLQJDQGQRWFKLQJ ([FHSWLRQV :KHUHVXEVWDQWLDWHGRWKHUZLVHE\DQDSSURYHG PHWKRG 'HPROLWLRQRIXQVDIHFRQGLWLRQVVKDOOEHSHU PLWWHGZKHUHDSSURYHGE\WKHFRGHRIILFLDO 6(&7,21 +$1'5$,/6$1'*8$5'5$,/6 *HQHUDO(YHU\ H[WHULRU DQG LQWHULRU IOLJKW RI VWDLUV KDYLQJPRUHWKDQIRXUULVHUVVKDOOKDYHDKDQGUDLORQRQHVLGH RIWKHVWDLUDQGHYHU\RSHQSRUWLRQRIDVWDLUODQGLQJEDO FRQ\SRUFKGHFNUDPSRURWKHUZDONLQJVXUIDFHWKDWLVPRUH WKDQLQFKHVPPDERYHWKHIORRURUJUDGHEHORZVKDOO KDYHJXDUGV+DQGUDLOVVKDOOEHQRWOHVVWKDQLQFKHV PPLQKHLJKWRUPRUHWKDQLQFKHVPPLQKHLJKW PHDVXUHGYHUWLFDOO\DERYHWKHQRVLQJRIWKHWUHDGRUDERYH WKHILQLVKHGIORRURIWKHODQGLQJRUZDONLQJVXUIDFHV*XDUGV VKDOOEHQRWOHVVWKDQLQFKHVPPLQKHLJKWDERYHWKH IORRURIWKHODQGLQJEDOFRQ\SRUFKGHFNRUUDPSRURWKHU ZDONLQJVXUIDFH ([FHSWLRQ*XDUGVVKDOOQRWEHUHTXLUHGZKHUHH[HPSWHG E\WKHDGRSWHGEXLOGLQJFRGH 6(&7,21 58%%,6+$1'*$5%$*( $FFXPXODWLRQRIUXEELVKRUJDUEDJH([WHULRUSURS HUW\DQGSUHPLVHVDQGWKHLQWHULRURIHYHU\VWUXFWXUHVKDOOEH IUHHIURPDQ\DFFXPXODWLRQRIUXEELVKRUJDUEDJH 'LVSRVDORIUXEELVK(YHU\RFFXSDQWRIDVWUXFWXUH VKDOOGLVSRVHRIDOOUXEELVKLQDFOHDQDQGVDQLWDU\PDQQHUE\ SODFLQJVXFKUXEELVKLQDSSURYHGFRQWDLQHUV 5XEELVKVWRUDJHIDFLOLWLHV7KHRZQHURIHYHU\ RFFXSLHGSUHPLVHVVKDOOVXSSO\DSSURYHGFRYHUHGFRQWDLQ HUVIRUUXEELVKDQGWKHRZQHURIWKHSUHPLVHVVKDOOEH UHVSRQVLEOHIRUWKHUHPRYDORIUXEELVK 5HIULJHUDWRUV5HIULJHUDWRUV DQG VLPLODU HTXLS PHQWQRWLQRSHUDWLRQVKDOOQRWEHGLVFDUGHGDEDQGRQHGRU VWRUHGRQSUHPLVHVZLWKRXWILUVWUHPRYLQJWKHGRRUV 'LVSRVDORIJDUEDJH(YHU\RFFXSDQWRIDVWUXFWXUH VKDOOGLVSRVHRIJDUEDJHLQDFOHDQDQGVDQLWDU\PDQQHUE\ SODFLQJVXFKJDUEDJHLQDQDSSURYHGJDUEDJHGLVSRVDOIDFLOLW\ RUDSSURYHGJDUEDJHFRQWDLQHUV *DUEDJHIDFLOLWLHV7KHRZQHURIHYHU\GZHOOLQJ VKDOOVXSSO\RQHRIWKHIROORZLQJDQDSSURYHGPHFKDQLFDO IRRG ZDVWH JULQGHU LQ HDFKGZHOOLQJ XQLWDQDSSURYHG LQFLQHUDWRUXQLWLQWKHVWUXFWXUHDYDLODEOHWRWKHRFFXSDQWV LQHDFKGZHOOLQJXQLWRUDQDSSURYHGOHDNSURRIFRYHUHG RXWVLGHJDUEDJHFRQWDLQHU &RQWDLQHUV7KHRSHUDWRURIHYHU\HVWDEOLVKPHQW SURGXFLQJJDUEDJHVKDOOSURYLGHDQGDWDOOWLPHVFDXVHWR EHXWLOL]HGDSSURYHGOHDNSURRIFRQWDLQHUVSURYLGHGZLWK FORVHILWWLQJFRYHUVIRUWKHVWRUDJHRIVXFKPDWHULDOVXQWLO UHPRYHGIURPWKHSUHPLVHVIRUGLVSRVDO 6(&7,21 3(67(/,0,1$7,21 ,QIHVWDWLRQ6WUXFWXUHVVKDOOEHNHSWIUHHIURPLQVHFW DQGURGHQWLQIHVWDWLRQ6WUXFWXUHVLQZKLFKLQVHFWVRUURGHQWV DUHIRXQGVKDOOEHSURPSWO\H[WHUPLQDWHGE\DSSURYHGSUR FHVVHVWKDWZLOOQRWEHLQMXULRXVWRKXPDQKHDOWK$IWHUSHVW Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 Page: 28 Number: 1 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:35:46 PM 308.1 Disposal of garbage or rubbish. The City of Richfield reserves the right to utilize the enforcement and notice processes in Section 601 of the Richfield City Code for garbage, yard waste and recyclables preparation, collection and disposal, scavenging and air pollution. *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( HOLPLQDWLRQSURSHUSUHFDXWLRQVVKDOOEHWDNHQWRSUHYHQWUHLQ IHVWDWLRQ 2ZQHU7KHRZQHURIDQ\VWUXFWXUHVKDOOEHUHVSRQVL EOHIRUSHVWHOLPLQDWLRQZLWKLQWKHVWUXFWXUHSULRUWRUHQWLQJRU OHDVLQJWKHVWUXFWXUH 6LQJOHRFFXSDQW7KHRFFXSDQWRIDRQHIDPLO\GZHOO LQJ RU RI D VLQJOHWHQDQW QRQUHVLGHQWLDO VWUXFWXUH VKDOO EH UHVSRQVLEOHIRUSHVWHOLPLQDWLRQRQWKHSUHPLVHV 0XOWLSOHRFFXSDQF\7KHRZQHURIDVWUXFWXUHFRQWDLQ LQJ WZR RU PRUHGZHOOLQJ XQLWVD PXOWLSOHRFFXSDQF\D URRPLQJKRXVHRUDQRQUHVLGHQWLDOVWUXFWXUHVKDOOEHUHVSRQVL EOHIRUSHVWHOLPLQDWLRQLQWKHSXEOLFRUVKDUHGDUHDVRIWKH VWUXFWXUHDQGH[WHULRUSURSHUW\,ILQIHVWDWLRQLVFDXVHGE\ IDLOXUHRIDQRFFXSDQWWRSUHYHQWVXFKLQIHVWDWLRQLQWKHDUHD RFFXSLHGWKHRFFXSDQWDQGRZQHUVKDOOEHUHVSRQVLEOHIRU SHVWHOLPLQDWLRQ 2FFXSDQW7KHRFFXSDQW RI DQ\ VWUXFWXUH VKDOO EH UHVSRQVLEOHIRUWKHFRQWLQXHGURGHQWDQGSHVWIUHHFRQGLWLRQ RIWKHVWUXFWXUH ([FHSWLRQ:KHUHWKHLQIHVWDWLRQVDUHFDXVHGE\GHIHFWV LQWKHVWUXFWXUHWKHRZQHUVKDOOEHUHVSRQVLEOHIRUSHVW HOLPLQDWLRQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 /,*+79(17,/$7,21$1'2&&83$1&</,0,7$7,216 User note: About this chapter:Chapter 4 sets forth requirements to establish the minimum environment for occupiable and habitable buildings by establishing the minimum criteria for light and ventilation and identifying occupancy limitations including minimum room width and area, mini- mum ceiling height and restrictions to prevent overcrowding. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPFRQGLWLRQVDQGVWDQGDUGVIRUOLJKWYHQWLODWLRQDQG VSDFHIRURFFXS\LQJDVWUXFWXUH 5HVSRQVLELOLW\7KHRZQHURIWKHVWUXFWXUHVKDOOSUR YLGHDQGPDLQWDLQOLJKWYHQWLODWLRQDQGVSDFHFRQGLWLRQVLQ FRPSOLDQFH ZLWK WKHVH UHTXLUHPHQWV $ SHUVRQ VKDOO QRW RFFXS\ DVRZQHURFFXSDQW RU SHUPLW DQRWKHU SHUVRQ WR RFFXS\DQ\SUHPLVHVWKDWGRQRWFRPSO\ZLWKWKHUHTXLUH PHQWVRIWKLVFKDSWHU $OWHUQDWLYHGHYLFHV,QOLHXRIWKHPHDQVIRUQDWXUDO OLJKW DQGYHQWLODWLRQ KHUHLQ SUHVFULEHG DUWLILFLDO OLJKW RU PHFKDQLFDOYHQWLODWLRQ FRPSO\LQJ ZLWK WKH,QWHUQDWLRQDO %XLOGLQJ&RGHVKDOOEHSHUPLWWHG 6(&7,21 /,*+7 +DELWDEOHVSDFHV(YHU\KDELWDEOHVSDFHVKDOOKDYH QRWOHVVWKDQRQHZLQGRZRIDSSURYHGVL]HIDFLQJGLUHFWO\WR WKHRXWGRRUVRUWRDFRXUW7KHPLQLPXPWRWDOJOD]HGDUHDIRU HYHU\KDELWDEOHVSDFHVKDOOEHSHUFHQWRIWKHIORRUDUHDRI VXFKURRP:KHUHYHUZDOOVRURWKHUSRUWLRQVRIDVWUXFWXUH IDFHDZLQGRZRIDQ\URRPDQGVXFKREVWUXFWLRQVDUHORFDWHG OHVVWKDQIHHWPPIURPWKHZLQGRZDQGH[WHQGWRD OHYHODERYHWKDWRIWKHFHLOLQJRIWKHURRPVXFKZLQGRZVKDOO QRWEHGHHPHGWRIDFHGLUHFWO\WRWKHRXWGRRUVQRUWRDFRXUW DQGVKDOOQRWEHLQFOXGHGDVFRQWULEXWLQJWRWKHUHTXLUHGPLQL PXPWRWDOZLQGRZDUHDIRUWKHURRP ([FHSWLRQ:KHUHQDWXUDOOLJKWIRUURRPVRUVSDFHVZLWK RXWH[WHULRUJOD]LQJDUHDVLVSURYLGHGWKURXJKDQDGMRLQLQJ URRP WKH XQREVWUXFWHG RSHQLQJ WR WKH DGMRLQLQJ URRP VKDOOEHQRWOHVVWKDQSHUFHQWRIWKHIORRUDUHDRIWKHLQWH ULRUURRPRUVSDFHRUQRWOHVVWKDQVTXDUHIHHW PZKLFKHYHULVJUHDWHU7KHH[WHULRUJOD]LQJDUHDVKDOO EHEDVHGRQWKHWRWDOIORRUDUHDEHLQJVHUYHG &RPPRQKDOOVDQGVWDLUZD\V(YHU\FRPPRQKDOO DQGVWDLUZD\LQUHVLGHQWLDORFFXSDQFLHVRWKHUWKDQLQRQH DQGWZRIDPLO\GZHOOLQJVVKDOOEHOLJKWHGDWDOOWLPHVZLWK QRWOHVVWKDQDZDWWVWDQGDUGLQFDQGHVFHQWOLJKWEXOEIRU HDFKVTXDUHIHHWPRIIORRUDUHDRUHTXLYDOHQWLOOX PLQDWLRQSURYLGHGWKDWWKHVSDFLQJEHWZHHQOLJKWVVKDOOQRW EHJUHDWHUWKDQIHHWPP,QRWKHUWKDQUHVLGHQWLDO RFFXSDQFLHVLQWHULRUDQGH[WHULRUPHDQVRIHJUHVVVWDLUZD\V VKDOOEHLOOXPLQDWHGDWDOOWLPHVWKHEXLOGLQJVSDFHVHUYHGE\ WKHPHDQVRIHJUHVVLVRFFXSLHGZLWKQRWOHVVWKDQIRRWFDQ GOHOX[DWIORRUVODQGLQJVDQGWUHDGV 2WKHUVSDFHV2WKHUVSDFHVVKDOOEHSURYLGHGZLWKQDW XUDORUDUWLILFLDOOLJKWVXIILFLHQWWRSHUPLWWKHPDLQWHQDQFHRI VDQLWDU\FRQGLWLRQVDQGWKHVDIHRFFXSDQF\RIWKHVSDFHDQG XWLOL]DWLRQRIWKHDSSOLDQFHVHTXLSPHQWDQGIL[WXUHV 6(&7,21 9(17,/$7,21 +DELWDEOHVSDFHV(YHU\KDELWDEOHVSDFHVKDOOKDYH QRWOHVVWKDQRQHRSHQDEOHZLQGRZ7KHWRWDORSHQDEOHDUHD RIWKHZLQGRZLQHYHU\URRPVKDOOEHHTXDOWRQRWOHVVWKDQ SHUFHQW RI WKH PLQLPXP JOD]HG DUHD UHTXLUHG LQ 6HFWLRQ ([FHSWLRQ:KHUHURRPVDQGVSDFHVZLWKRXWRSHQLQJVWR WKHRXWGRRUVDUHYHQWLODWHGWKURXJKDQDGMRLQLQJURRPWKH XQREVWUXFWHGRSHQLQJWRWKHDGMRLQLQJURRPVKDOOEHQRW OHVVWKDQSHUFHQWRIWKHIORRUDUHDRIWKHLQWHULRUURRPRU VSDFHEXWQRWOHVVWKDQVTXDUHIHHWP7KHYHQWL ODWLRQRSHQLQJVWRWKHRXWGRRUVVKDOOEHEDVHGRQDWRWDO IORRUDUHDEHLQJYHQWLODWHG %DWKURRPVDQGWRLOHWURRPV(YHU\EDWKURRPDQGWRL OHWURRPVKDOOFRPSO\ZLWKWKHYHQWLODWLRQUHTXLUHPHQWVIRU KDELWDEOHVSDFHVDVUHTXLUHGE\6HFWLRQH[FHSWWKDWD ZLQGRZVKDOOQRWEHUHTXLUHGLQVXFKVSDFHVHTXLSSHGZLWKD PHFKDQLFDOYHQWLODWLRQV\VWHP$LUH[KDXVWHGE\DPHFKDQL FDOYHQWLODWLRQV\VWHPIURPDEDWKURRPRUWRLOHWURRPVKDOO GLVFKDUJHWRWKHRXWGRRUVDQGVKDOOQRWEHUHFLUFXODWHG &RRNLQJIDFLOLWLHV8QOHVVDSSURYHGWKURXJKWKHFHUWLI LFDWHRIRFFXSDQF\FRRNLQJVKDOOQRWEHSHUPLWWHGLQDQ\ URRPLQJ XQLW RU GRUPLWRU\ XQLW DQG D FRRNLQJ IDFLOLW\ RU DSSOLDQFHVKDOOQRWEHSHUPLWWHGWREHSUHVHQWLQWKHURRPLQJ XQLWRUGRUPLWRU\XQLW ([FHSWLRQV :KHUHVSHFLILFDOO\DSSURYHGLQZULWLQJE\WKHFRGH RIILFLDO 'HYLFHVVXFKDVFRIIHHSRWVDQGPLFURZDYHRYHQV VKDOOQRWEHFRQVLGHUHGFRRNLQJDSSOLDQFHV 3URFHVVYHQWLODWLRQ:KHUHLQMXULRXVWR[LFLUULWDWLQJ RUQR[LRXVIXPHVJDVHVGXVWVRUPLVWVDUHJHQHUDWHGDORFDO H[KDXVWYHQWLODWLRQV\VWHPVKDOOEHSURYLGHGWRUHPRYHWKH FRQWDPLQDWLQJDJHQWDWWKHVRXUFH$LUVKDOOEHH[KDXVWHGWR WKHH[WHULRUDQGQRWEHUHFLUFXODWHGWRDQ\VSDFH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,QWHUQDWLRQDO 12 Page: 30 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:19:11 AM -05'00' MSBC Number: 2 Author: MPoehlman Date: 12/23/2019 2:36:05 PM /,*+79(17,/$7,21$1'2&&83$1&</,0,7$7,216 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &ORWKHVGU\HUH[KDXVW&ORWKHVGU\HUH[KDXVWV\VWHPV VKDOO EH LQGHSHQGHQW RI DOO RWKHU V\VWHPV DQG VKDOO EH H[KDXVWHGRXWVLGHWKHVWUXFWXUHLQDFFRUGDQFHZLWKWKHPDQX IDFWXUHU¶VLQVWUXFWLRQV ([FHSWLRQ /LVWHG DQGODEHOHG FRQGHQVLQJ GXFWOHVV FORWKHVGU\HUV 6(&7,21 2&&83$1&</,0,7$7,216 3ULYDF\'ZHOOLQJ XQLWV KRWHO XQLWVKRXVHNHHSLQJ XQLWVURRPLQJXQLWVDQGGRUPLWRU\XQLWVVKDOOEHDUUDQJHGWR SURYLGHSULYDF\DQGEHVHSDUDWHIURPRWKHUDGMRLQLQJVSDFHV 0LQLPXPURRPZLGWKV$KDELWDEOHURRPRWKHUWKDQ DNLWFKHQVKDOOEHQRWOHVVWKDQIHHWPPLQDQ\SODQ GLPHQVLRQ.LWFKHQVVKDOOKDYHDPLQLPXPFOHDUSDVVDJHZD\ RIIHHWPPEHWZHHQFRXQWHUIURQWVDQGDSSOLDQFHVRU FRXQWHUIURQWVDQGZDOOV 0LQLPXP FHLOLQJ KHLJKWV+DELWDEOH VSDFHV KDOO ZD\VFRUULGRUVODXQGU\DUHDVEDWKURRPVWRLOHWURRPVDQG KDELWDEOHEDVHPHQWDUHDVVKDOOKDYHDPLQLPXPFOHDUFHLOLQJ KHLJKWRIIHHWPP ([FHSWLRQV ,QRQHDQGWZRIDPLO\GZHOOLQJVEHDPVRUJLUGHUV VSDFHGQRWOHVVWKDQIHHWPPRQFHQWHUDQG SURMHFWLQJQRWJUHDWHUWKDQLQFKHVPPEHORZ WKHUHTXLUHGFHLOLQJKHLJKW %DVHPHQWURRPVLQRQHDQGWZRIDPLO\GZHOOLQJV RFFXSLHGH[FOXVLYHO\IRUODXQGU\VWXG\RUUHFUHDWLRQ SXUSRVHVKDYLQJDPLQLPXPFHLOLQJKHLJKWRIIHHW LQFKHVPPZLWKDPLQLPXPFOHDUKHLJKWRI IHHW LQFKHVPPXQGHU EHDPV JLUGHUV GXFWVDQGVLPLODUREVWUXFWLRQV 5RRPVRFFXSLHGH[FOXVLYHO\IRUVOHHSLQJVWXG\RU VLPLODUSXUSRVHVDQGKDYLQJDVORSHGFHLOLQJRYHUDOO RUSDUWRIWKHURRPZLWKDPLQLPXPFOHDUFHLOLQJ KHLJKWRIIHHWPPRYHUQRWOHVVWKDQRQH WKLUGRIWKHUHTXLUHGPLQLPXPIORRUDUHD,QFDOFX ODWLQJWKHIORRUDUHDRIVXFKURRPVRQO\WKRVHSRU WLRQVRIWKHIORRUDUHDZLWKDPLQLPXPFOHDUFHLOLQJ KHLJKWRIIHHWPPVKDOOEHLQFOXGHG %HGURRPDQGOLYLQJURRPUHTXLUHPHQWV(YHU\EHG URRPDQGOLYLQJURRPVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRI 6HFWLRQVWKURXJK 5RRPDUHD(YHU\OLYLQJURRPVKDOOFRQWDLQQRW OHVVWKDQVTXDUHIHHWPDQGHYHU\EHGURRP VKDOOFRQWDLQ QRW OHVVWKDQVTXDUH IHHW P DQG HYHU\EHGURRPRFFXSLHGE\PRUHWKDQRQHSHUVRQVKDOO FRQWDLQQRWOHVVWKDQVTXDUHIHHWPRIIORRUDUHD IRUHDFKRFFXSDQWWKHUHRI $FFHVVIURPEHGURRPV%HGURRPVVKDOOQRWFRQ VWLWXWHWKHRQO\PHDQVRIDFFHVVWRRWKHUEHGURRPVRUKDE LWDEOH VSDFHV DQG VKDOO QRW VHUYH DVWKH RQO\PHDQV RI HJUHVVIURPRWKHUKDELWDEOHVSDFHV ([FHSWLRQ 8QLWV WKDW FRQWDLQ IHZHU WKDQ WZREHG URRPV :DWHUFORVHWDFFHVVLELOLW\(YHU\EHGURRPVKDOO KDYHDFFHVVWRQRWOHVVWKDQRQHZDWHUFORVHWDQGRQHODYD WRU\ZLWKRXWSDVVLQJWKURXJKDQRWKHUEHGURRP(YHU\EHG URRPLQDGZHOOLQJXQLWVKDOOKDYHDFFHVVWRQRWOHVVWKDQ RQHZDWHUFORVHWDQGODYDWRU\ORFDWHGLQWKHVDPHVWRU\DV WKHEHGURRPRUDQDGMDFHQWVWRU\ 3URKLELWHG RFFXSDQF\ .LWFKHQV DQG QRQKDELW DEOHVSDFHVVKDOOQRWEHXVHGIRUVOHHSLQJSXUSRVHV 2WKHU UHTXLUHPHQWV%HGURRPV VKDOO FRPSO\ ZLWKWKHDSSOLFDEOHSURYLVLRQVRIWKLVFRGHLQFOXGLQJEXW QRW OLPLWHG WR WKH OLJKWYHQWLODWLRQ URRP DUHD FHLOLQJ KHLJKWDQGURRPZLGWKUHTXLUHPHQWVRIWKLVFKDSWHUWKH SOXPELQJ IDFLOLWLHV DQG ZDWHUKHDWLQJ IDFLOLWLHV UHTXLUH PHQWVRI&KDSWHUWKHKHDWLQJIDFLOLWLHVDQGHOHFWULFDO UHFHSWDFOH UHTXLUHPHQWV RI &KDSWHU DQG WKH VPRNH GHWHFWRUDQGHPHUJHQF\HVFDSHUHTXLUHPHQWVRI&KDSWHU 2YHUFURZGLQJ'ZHOOLQJXQLWVVKDOOQRWEHRFFXSLHG E\ PRUH RFFXSDQWV WKDQ SHUPLWWHG E\ WKH PLQLPXP DUHD UHTXLUHPHQWVRI7DEOH 7$%/( 0,1,080$5($5(48,5(0(176 )RU6, VTXDUHIRRW P D 6HH6HFWLRQIRUFRPELQHGOLYLQJURRPGLQLQJURRPVSDFHV E 6HH 6HFWLRQ IRU OLPLWDWLRQV RQ GHWHUPLQLQJ WKH PLQLPXP RFFXSDQF\DUHDIRUVOHHSLQJSXUSRVHV 6OHHSLQJ DUHD 7KH PLQLPXP RFFXSDQF\ DUHD UHTXLUHGE\7DEOHVKDOOQRWEHLQFOXGHGDVDVOHHSLQJ DUHD LQ GHWHUPLQLQJ WKH PLQLPXP RFFXSDQF\ DUHD IRU VOHHSLQJSXUSRVHV6OHHSLQJDUHDVVKDOOFRPSO\ZLWK6HF WLRQ &RPELQHG VSDFHV &RPELQHG OLYLQJ URRP DQG GLQLQJURRPVSDFHVVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRI 7DEOHLIWKHWRWDODUHDLVHTXDOWRWKDWUHTXLUHGIRU VHSDUDWHURRPVDQGLIWKHVSDFHLVORFDWHGVRDVWRIXQFWLRQ DVDFRPELQDWLRQOLYLQJURRPGLQLQJURRP (IILFLHQF\XQLW1RWKLQJLQWKLVVHFWLRQVKDOOSURKLELW DQHIILFLHQF\OLYLQJXQLWIURPPHHWLQJWKHIROORZLQJUHTXLUH PHQWV $XQLWRFFXSLHGE\QRWPRUHWKDQRQHRFFXSDQWVKDOO KDYHDPLQLPXPFOHDUIORRUDUHDRIVTXDUHIHHW P$XQLWRFFXSLHGE\QRWPRUHWKDQWZRRFFX SDQWV VKDOO KDYHD PLQLPXPFOHDU IORRUDUHDRI VTXDUHIHHWP$XQLWRFFXSLHGE\WKUHHRFFX SDQWV VKDOO KDYHD PLQLPXPFOHDU IORRUDUHDRI VTXDUH IHHW P 7KHVH UHTXLUHG DUHDV VKDOO EH H[FOXVLYHRIWKHDUHDVUHTXLUHGE\,WHPVDQG 7KHXQLWVKDOOEHSURYLGHGZLWKDNLWFKHQVLQNFRRNLQJ DSSOLDQFH DQG UHIULJHUDWLRQ IDFLOLWLHV HDFK KDYLQJ D PLQLPXPFOHDUZRUNLQJVSDFHRILQFKHVPP 63$&( 0,1,080$5($,1648$5()((7 RFFXSDQWV RFFXSDQWV RUPRUHRFFXSDQWV /LYLQJURRPDE 'LQLQJURRPDE 1R UHTXLUHPHQW %HGURRPV 6KDOOFRPSO\ZLWK6HFWLRQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 /,*+79(17,/$7,21$1'2&&83$1&</,0,7$7,216 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( LQIURQW/LJKWDQGYHQWLODWLRQFRQIRUPLQJWRWKLVFRGH VKDOOEHSURYLGHG 7KHXQLWVKDOOEHSURYLGHGZLWKDVHSDUDWHEDWKURRP FRQWDLQLQJ D ZDWHU FORVHW ODYDWRU\ DQG EDWKWXE RU VKRZHU 7KHPD[LPXPQXPEHURIRFFXSDQWVVKDOOEHWKUHH )RRGSUHSDUDWLRQ6SDFHVWREHRFFXSLHGIRUIRRG SUHSDUDWLRQSXUSRVHVVKDOOFRQWDLQVXLWDEOHVSDFHDQGHTXLS PHQWWRVWRUHSUHSDUHDQGVHUYHIRRGVLQDVDQLWDU\PDQQHU 7KHUHVKDOOEHDGHTXDWHIDFLOLWLHVDQGVHUYLFHVIRUWKHVDQL WDU\GLVSRVDORIIRRGZDVWHVDQGUHIXVHLQFOXGLQJIDFLOLWLHV IRUWHPSRUDU\VWRUDJH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 3/80%,1*)$&,/,7,(6$1'),;785(5(48,5(0(176 User note: About this chapter:Chapter 5 establishes minimum sanitary and clean conditions in occupied buildings by containing requirements for the installation, maintenance and location of plumbing systems and facilities, including the water supply system, water heating appliances, sew- age disposal systems and related plumbing fixtures. Chapter 5 includes requirements for providing potable water to a building and the basic fixtures to effectively utilize and dispose of that water. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPSOXPELQJV\VWHPVIDFLOLWLHVDQGSOXPELQJIL[WXUHV WREHSURYLGHG 5HVSRQVLELOLW\7KHRZQHURIWKHVWUXFWXUHVKDOOSUR YLGHDQGPDLQWDLQVXFKSOXPELQJIDFLOLWLHVDQGSOXPELQJIL[ WXUHVLQFRPSOLDQFHZLWKWKHVHUHTXLUHPHQWV$SHUVRQVKDOO QRWRFFXS\DVRZQHURFFXSDQWRUSHUPLWDQRWKHUSHUVRQWR RFFXS\DQ\VWUXFWXUHRUSUHPLVHVWKDWGRHVQRWFRPSO\ZLWK WKHUHTXLUHPHQWVRIWKLVFKDSWHU 6(&7,21 5(48,5(')$&,/,7,(6 >3@'ZHOOLQJXQLWV(YHU\GZHOOLQJXQLWVKDOOFRQWDLQ LWVRZQEDWKWXERUVKRZHUODYDWRU\ZDWHUFORVHWDQGNLWFKHQ VLQNWKDWVKDOOEHPDLQWDLQHGLQDVDQLWDU\VDIHZRUNLQJFRQ GLWLRQ7KHODYDWRU\VKDOOEHSODFHGLQWKHVDPHURRPDVWKH ZDWHUFORVHWRUORFDWHGLQFORVHSUR[LPLW\WRWKHGRRUOHDGLQJ GLUHFWO\LQWRWKHURRPLQZKLFKVXFKZDWHUFORVHWLVORFDWHG$ NLWFKHQVLQNVKDOOQRWEHXVHGDVDVXEVWLWXWHIRUWKHUHTXLUHG ODYDWRU\ >3@5RRPLQJKRXVHV1RWOHVVWKDQRQHZDWHUFORVHW ODYDWRU\DQGEDWKWXERUVKRZHUVKDOOEHVXSSOLHGIRUHDFKIRXU URRPLQJXQLWV >3@+RWHOV:KHUHSULYDWHZDWHUFORVHWVODYDWRULHVDQG EDWKVDUHQRWSURYLGHGRQHZDWHUFORVHWRQHODYDWRU\DQGRQH EDWKWXERUVKRZHUKDYLQJDFFHVVIURPDSXEOLFKDOOZD\VKDOO EHSURYLGHGIRUHDFKRFFXSDQWV >3@ (PSOR\HHV¶ IDFLOLWLHV 1RW OHVV WKDQ RQH ZDWHU FORVHWRQHODYDWRU\DQGRQHGULQNLQJIDFLOLW\VKDOOEHDYDLO DEOHWRHPSOR\HHV >3@'ULQNLQJIDFLOLWLHV'ULQNLQJIDFLOLWLHVVKDOO EHDGULQNLQJIRXQWDLQZDWHUFRROHUERWWOHGZDWHUFRROHU RU GLVSRVDEOH FXSV QH[W WR D VLQN RU ZDWHU GLVSHQVHU 'ULQNLQJIDFLOLWLHVVKDOOQRWEHORFDWHGLQWRLOHWURRPVRU EDWKURRPV >3@3XEOLFWRLOHWIDFLOLWLHV3XEOLFWRLOHWIDFLOLWLHVVKDOO EHPDLQWDLQHGLQDVDIHVDQLWDU\DQGZRUNLQJFRQGLWLRQLQ DFFRUGDQFHZLWKWKH,QWHUQDWLRQDO3OXPELQJ&RGH([FHSWIRU SHULRGLFPDLQWHQDQFHRUFOHDQLQJSXEOLFDFFHVVDQGXVHVKDOO EHSURYLGHGWRWKHWRLOHWIDFLOLWLHVDWDOOWLPHVGXULQJRFFX SDQF\RIWKHSUHPLVHV 6(&7,21 72,/(752206 >3@3ULYDF\7RLOHWURRPVDQGEDWKURRPVVKDOOSURYLGH SULYDF\DQGVKDOOQRWFRQVWLWXWHWKHRQO\SDVVDJHZD\WRDKDOO RURWKHUVSDFHRUWRWKHH[WHULRU$GRRUDQGLQWHULRUORFNLQJ GHYLFHVKDOOEHSURYLGHGIRUDOOFRPPRQRUVKDUHGEDWKURRPV DQGWRLOHWURRPVLQDPXOWLSOHGZHOOLQJ >3@ /RFDWLRQ7RLOHW URRPVDQGEDWKURRPV VHUYLQJ KRWHOXQLWVURRPLQJXQLWVRUGRUPLWRU\XQLWVRUKRXVHNHHSLQJ XQLWVVKDOOKDYHDFFHVVE\WUDYHUVLQJQRWPRUHWKDQRQHIOLJKW RIVWDLUVDQGVKDOOKDYHDFFHVVIURPDFRPPRQKDOORUSDV VDJHZD\ >3@/RFDWLRQRIHPSOR\HHWRLOHWIDFLOLWLHV7RLOHWIDFLO LWLHVVKDOOKDYHDFFHVVIURPZLWKLQWKHHPSOR\HHV¶ZRUNLQJ DUHD7KHUHTXLUHGWRLOHWIDFLOLWLHVVKDOOEHORFDWHGQRWPRUH WKDQRQHVWRU\DERYHRUEHORZWKHHPSOR\HHV¶ZRUNLQJDUHD DQGWKHSDWKRIWUDYHOWRVXFKIDFLOLWLHVVKDOOQRWH[FHHGDGLV WDQFHRIIHHWP(PSOR\HHIDFLOLWLHVVKDOOHLWKHUEH VHSDUDWHIDFLOLWLHVRUFRPELQHGHPSOR\HHDQGSXEOLFIDFLOLWLHV ([FHSWLRQ)DFLOLWLHVWKDWDUHUHTXLUHGIRUHPSOR\HHVLQ VWRUDJHVWUXFWXUHVRUNLRVNVZKLFKDUHORFDWHGLQDGMDFHQW VWUXFWXUHV XQGHU WKH VDPH RZQHUVKLS OHDVH RU FRQWURO VKDOOQRWH[FHHGDWUDYHOGLVWDQFHRIIHHWPIURP WKHHPSOR\HHV¶UHJXODUZRUNLQJDUHDWRWKHIDFLOLWLHV >3@)ORRUVXUIDFH,QRWKHUWKDQGZHOOLQJXQLWVHYHU\ WRLOHWURRPIORRUVKDOOEHPDLQWDLQHGWREHDVPRRWKKDUG QRQDEVRUEHQWVXUIDFHWRSHUPLWVXFKIORRUWREHHDVLO\NHSWLQ DFOHDQDQGVDQLWDU\FRQGLWLRQ 6(&7,21 3/80%,1*6<67(06$1'),;785(6 >3@ *HQHUDO 3OXPELQJ IL[WXUHV VKDOO EH SURSHUO\ LQVWDOOHGDQGPDLQWDLQHGLQZRUNLQJRUGHUDQGVKDOOEHNHSW IUHHIURPREVWUXFWLRQVOHDNVDQGGHIHFWVDQGEHFDSDEOHRI SHUIRUPLQJWKHIXQFWLRQIRUZKLFKVXFKSOXPELQJIL[WXUHVDUH GHVLJQHG3OXPELQJIL[WXUHVVKDOOEHPDLQWDLQHGLQDVDIH VDQLWDU\DQGIXQFWLRQDOFRQGLWLRQ >3@)L[WXUHFOHDUDQFHV3OXPELQJIL[WXUHVVKDOOKDYH DGHTXDWHFOHDUDQFHVIRUXVDJHDQGFOHDQLQJ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 3/80%,1*)$&,/,7,(6$1'),;785(5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( >3@3OXPELQJV\VWHPKD]DUGV:KHUHLWLVIRXQGWKDW DSOXPELQJV\VWHPLQDVWUXFWXUHFRQVWLWXWHVDKD]DUGWRWKH RFFXSDQWVRUWKHVWUXFWXUHE\UHDVRQRILQDGHTXDWHVHUYLFH LQDGHTXDWH YHQWLQJ FURVV FRQQHFWLRQ EDFNVLSKRQDJH LPSURSHULQVWDOODWLRQGHWHULRUDWLRQRUGDPDJHRUIRUVLPLODU UHDVRQVWKHFRGHRIILFLDOVKDOOUHTXLUHWKHGHIHFWVWREHFRU UHFWHGWRHOLPLQDWHWKHKD]DUG 6(&7,21 :$7(56<67(0 >3@*HQHUDO(YHU\VLQNODYDWRU\EDWKWXERUVKRZHU GULQNLQJIRXQWDLQZDWHUFORVHWRURWKHUSOXPELQJIL[WXUHVKDOO EHSURSHUO\FRQQHFWHGWRHLWKHUDSXEOLFZDWHUV\VWHPRUWRDQ DSSURYHG SULYDWH ZDWHU V\VWHP .LWFKHQ VLQNV ODYDWRULHV ODXQGU\ IDFLOLWLHV EDWKWXEV DQG VKRZHUV VKDOO EH VXSSOLHG ZLWKKRWRUWHPSHUHGDQGFROGUXQQLQJZDWHULQDFFRUGDQFH ZLWKWKH,QWHUQDWLRQDO3OXPELQJ&RGH >3@&RQWDPLQDWLRQ7KHZDWHUVXSSO\VKDOOEHPDLQ WDLQHG IUHH IURP FRQWDPLQDWLRQ DQG DOO ZDWHU LQOHWV IRU SOXPELQJIL[WXUHVVKDOOEHORFDWHGDERYHWKHIORRGOHYHOULP RIWKHIL[WXUH6KDPSRREDVLQIDXFHWVMDQLWRUVLQNIDXFHWVDQG RWKHUKRVHELEVRUIDXFHWVWRZKLFKKRVHVDUHDWWDFKHGDQGOHIW LQSODFHVKDOOEHSURWHFWHGE\DQDSSURYHGDWPRVSKHULFW\SH YDFXXPEUHDNHURUDQDSSURYHGSHUPDQHQWO\DWWDFKHGKRVH FRQQHFWLRQYDFXXPEUHDNHU >3@6XSSO\7KHZDWHUVXSSO\V\VWHPVKDOOEHLQVWDOOHG DQGPDLQWDLQHGWRSURYLGHDVXSSO\RIZDWHUWRSOXPELQJIL[ WXUHVGHYLFHVDQGDSSXUWHQDQFHVLQVXIILFLHQWYROXPHDQGDW SUHVVXUHVDGHTXDWHWRHQDEOHWKHIL[WXUHVWRIXQFWLRQSURSHUO\ VDIHO\DQGIUHHIURPGHIHFWVDQGOHDNV >3@:DWHUKHDWLQJIDFLOLWLHV:DWHUKHDWLQJIDFLOLWLHV VKDOOEHSURSHUO\LQVWDOOHGPDLQWDLQHGDQGFDSDEOHRISURYLG LQJ DQ DGHTXDWH DPRXQW RI ZDWHU WR EH GUDZQ DW HYHU\ UHTXLUHGVLQNODYDWRU\EDWKWXEVKRZHUDQGODXQGU\IDFLOLW\ DWDWHPSHUDWXUHQRWOHVVWKDQ)&$JDVEXUQLQJ ZDWHU KHDWHU VKDOO QRW EH ORFDWHG LQ DQ\EDWKURRPWRLOHW URRPEHGURRPRURWKHURFFXSLHGURRPQRUPDOO\NHSWFORVHG XQOHVV DGHTXDWH FRPEXVWLRQ DLU LV SURYLGHG $QDSSURYHG FRPELQDWLRQWHPSHUDWXUHDQGSUHVVXUHUHOLHIYDOYHDQGUHOLHI YDOYHGLVFKDUJHSLSHVKDOOEHSURSHUO\LQVWDOOHGDQGPDLQ WDLQHGRQZDWHUKHDWHUV >3@ 1RQSRWDEOH ZDWHU UHXVH V\VWHPV 1RQSRWDEOH ZDWHUUHXVHV\VWHPVDQGUDLQZDWHUFROOHFWLRQDQGFRQYH\DQFH V\VWHPVVKDOOEHPDLQWDLQHGLQDVDIHDQGVDQLWDU\FRQGLWLRQ :KHUHVXFKV\VWHPVDUHQRWSURSHUO\PDLQWDLQHGWKHV\VWHPV VKDOOEHUHSDLUHGWRSURYLGHIRUVDIHDQGVDQLWDU\FRQGLWLRQV RUWKHV\VWHPVKDOOEHDEDQGRQHGLQDFFRUGDQFHZLWK6HFWLRQ >3@$EDQGRQPHQWRIV\VWHPV:KHUHDQRQSRWD EOHZDWHUUHXVHV\VWHPRUDUDLQZDWHUFROOHFWLRQDQGGLVWUL EXWLRQV\VWHPLVQRWPDLQWDLQHGRUWKHRZQHUFHDVHVXVHRI WKHV\VWHPWKHV\VWHPVKDOOEHDEDQGRQHGLQDFFRUGDQFH ZLWK6HFWLRQRIWKH,QWHUQDWLRQDO3OXPELQJ&RGH 6(&7,21 6$1,7$5<'5$,1$*(6<67(0 >3@*HQHUDO3OXPELQJIL[WXUHVVKDOOEHSURSHUO\FRQ QHFWHGWRHLWKHUDSXEOLFVHZHUV\VWHPRUWRDQDSSURYHGSUL YDWHVHZDJHGLVSRVDOV\VWHP >3@0DLQWHQDQFH(YHU\SOXPELQJVWDFNYHQWZDVWH DQGVHZHUOLQHVKDOOIXQFWLRQSURSHUO\DQGEHNHSWIUHHIURP REVWUXFWLRQVOHDNVDQGGHIHFWV >3@*UHDVHLQWHUFHSWRUV*UHDVHLQWHUFHSWRUVDQGDXWR PDWLFJUHDVHUHPRYDOGHYLFHVVKDOOEHPDLQWDLQHGLQDFFRU GDQFH ZLWK WKLV FRGH DQG WKH PDQXIDFWXUHU¶V LQVWDOODWLRQ LQVWUXFWLRQV *UHDVH LQWHUFHSWRUV DQG DXWRPDWLF JUHDVH UHPRYDOGHYLFHVVKDOOEHUHJXODUO\VHUYLFHGDQGFOHDQHGWR SUHYHQWWKH GLVFKDUJH RI RLO JUHDVH DQG RWKHU VXEVWDQFHV KDUPIXORUKD]DUGRXVWRWKHEXLOGLQJGUDLQDJHV\VWHPWKH SXEOLFVHZHUWKHSULYDWHVHZDJHGLVSRVDOV\VWHPRUWKHVHZ DJHWUHDWPHQW SODQWRUSURFHVVHV5HFRUGVRIPDLQWHQDQFH FOHDQLQJDQGUHSDLUVVKDOOEHDYDLODEOHIRULQVSHFWLRQE\WKH FRGHRIILFLDO 6(&7,21 67250'5$,1$*( >3@*HQHUDO'UDLQDJHRIURRIVDQGSDYHGDUHDV\DUGV DQGFRXUWVDQGRWKHURSHQDUHDVRQWKHSUHPLVHVVKDOOQRWEH GLVFKDUJHGLQDPDQQHUWKDWFUHDWHVDSXEOLFQXLVDQFH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 User note: About this chapter:Chapter 6 establishes minimum performance requirements for heating, electrical and mechanical facilities serving exist- ing structures, such as heating and air-conditioning equipment, appliances and their supporting systems; water heating equipment, appli- ances and systems; cooking equipment and appliances; ventilation and exhaust equipment; gas and liquid fuel distribution piping and components; fireplaces and solid fuel-burning appliances; chimneys and vents; electrical services; lighting fixtures; electrical receptacle out- lets; electrical distribution system equipment, devices and wiring; and elevators, escalators and dumbwaiters. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPPHFKDQLFDODQGHOHFWULFDOIDFLOLWLHVDQGHTXLSPHQW WREHSURYLGHG 5HVSRQVLELOLW\7KHRZQHURIWKHVWUXFWXUHVKDOOSUR YLGH DQG PDLQWDLQ PHFKDQLFDO DQG HOHFWULFDO IDFLOLWLHV DQG HTXLSPHQWLQFRPSOLDQFHZLWKWKHVHUHTXLUHPHQWV$SHUVRQ VKDOOQRWRFFXS\DVRZQHURFFXSDQWRUSHUPLWDQRWKHUSHUVRQ WRRFFXS\DQ\SUHPLVHV WKDW GRHV QRW FRPSO\ ZLWK WKH UHTXLUHPHQWVRIWKLVFKDSWHU 6(&7,21 +($7,1*)$&,/,7,(6 )DFLOLWLHV UHTXLUHG +HDWLQJ IDFLOLWLHV VKDOO EH SUR YLGHGLQVWUXFWXUHVDVUHTXLUHGE\WKLVVHFWLRQ 5HVLGHQWLDORFFXSDQFLHV'ZHOOLQJVVKDOOEHSURYLGHG ZLWKKHDWLQJIDFLOLWLHVFDSDEOHRIPDLQWDLQLQJDURRPWHP SHUDWXUHRI)&LQDOOKDELWDEOHURRPVEDWKURRPV DQGWRLOHWURRPVEDVHGRQWKHZLQWHURXWGRRUGHVLJQWHPSHUD WXUHIRUWKHORFDOLW\LQGLFDWHGLQ$SSHQGL['RIWKH,QWHUQD WLRQDO3OXPELQJ&RGH&RRNLQJDSSOLDQFHVVKDOOQRWEHXVHG QRU VKDOO SRUWDEOH XQYHQWHG IXHOEXUQLQJ VSDFH KHDWHUV EH XVHGDVDPHDQVWRSURYLGHUHTXLUHGKHDWLQJ ([FHSWLRQ,QDUHDVZKHUHWKHDYHUDJHPRQWKO\WHPSHUD WXUHLVDERYH)&DPLQLPXPWHPSHUDWXUHRI) &VKDOOEHPDLQWDLQHG +HDWVXSSO\(YHU\RZQHUDQGRSHUDWRURIDQ\EXLOG LQJZKRUHQWVOHDVHVRUOHWVRQHRUPRUHGZHOOLQJXQLWVRU VOHHSLQJXQLWVRQWHUPVHLWKHUH[SUHVVHGRULPSOLHGWRIXU QLVKKHDWWRWKHRFFXSDQWVWKHUHRIVKDOOVXSSO\KHDWGXULQJWKH SHULRGIURP>'$7(@WR>'$7(@WRPDLQWDLQDPLQLPXPWHP SHUDWXUHRI)&LQDOOKDELWDEOHURRPVEDWKURRPV DQGWRLOHWURRPV ([FHSWLRQV :KHQWKHRXWGRRUWHPSHUDWXUHLVEHORZWKHZLQWHU RXWGRRUGHVLJQWHPSHUDWXUHIRUWKHORFDOLW\PDLQWH QDQFHRIWKHPLQLPXPURRPWHPSHUDWXUHVKDOOQRW EHUHTXLUHGSURYLGHGWKDWWKHKHDWLQJV\VWHPLVRSHU DWLQJDWLWVIXOOGHVLJQFDSDFLW\7KHZLQWHURXWGRRU GHVLJQWHPSHUDWXUHIRUWKHORFDOLW\VKDOOEHDVLQGL FDWHGLQ$SSHQGL['RIWKH,QWHUQDWLRQDO3OXPELQJ &RGH ,QDUHDVZKHUHWKHDYHUDJHPRQWKO\WHPSHUDWXUHLV DERYH)&DPLQLPXPWHPSHUDWXUHRI) &VKDOOEHPDLQWDLQHG 2FFXSLDEOH ZRUN VSDFHV ,QGRRU RFFXSLDEOH ZRUN VSDFHVVKDOOEHVXSSOLHGZLWKKHDWGXULQJWKHSHULRGIURP >'$7(@WR>'$7(@WRPDLQWDLQDPLQLPXPWHPSHUDWXUHRI) &GXULQJWKHSHULRGWKHVSDFHVDUHRFFXSLHG ([FHSWLRQV 3URFHVVLQJVWRUDJHDQGRSHUDWLRQDUHDVWKDWUHTXLUH FRROLQJRUVSHFLDOWHPSHUDWXUHFRQGLWLRQV $UHDV LQ ZKLFK SHUVRQV DUH SULPDULO\ HQJDJHG LQ YLJRURXVSK\VLFDODFWLYLWLHV 5RRPWHPSHUDWXUHPHDVXUHPHQW7KHUHTXLUHGURRP WHPSHUDWXUHVVKDOOEHPHDVXUHGIHHWPPDERYHWKH IORRUQHDUWKHFHQWHURIWKHURRPDQGIHHWPPLQZDUG IURPWKHFHQWHURIHDFKH[WHULRUZDOO 6(&7,21 0(&+$1,&$/(48,30(17 0HFKDQLFDOHTXLSPHQWDQGDSSOLDQFHV0HFKDQLFDO HTXLSPHQWDSSOLDQFHVILUHSODFHV VROLGIXHOEXUQLQJ DSSOL DQFHVFRRNLQJDSSOLDQFHVDQGZDWHUKHDWLQJDSSOLDQFHVVKDOO EHSURSHUO\LQVWDOOHGDQGPDLQWDLQHGLQDVDIHZRUNLQJFRQGL WLRQDQGVKDOOEHFDSDEOHRISHUIRUPLQJWKHLQWHQGHGIXQF WLRQ 5HPRYDO RI FRPEXVWLRQ SURGXFWV )XHOEXUQLQJ HTXLSPHQWDQGDSSOLDQFHVVKDOOEHFRQQHFWHGWRDQDSSURYHG FKLPQH\RUYHQW ([FHSWLRQ)XHOEXUQLQJHTXLSPHQWDQGDSSOLDQFHVWKDW DUHODEHOHGIRUXQYHQWHGRSHUDWLRQ &OHDUDQFHV5HTXLUHGFOHDUDQFHVWRFRPEXVWLEOHPDWH ULDOVVKDOOEHPDLQWDLQHG 6DIHW\ FRQWUROV 6DIHW\ FRQWUROV IRU IXHOEXUQLQJ HTXLSPHQWVKDOOEHPDLQWDLQHGLQHIIHFWLYHRSHUDWLRQ &RPEXVWLRQDLU$VXSSO\RIDLUIRUFRPSOHWHFRPEXV WLRQRIWKHIXHODQGIRUYHQWLODWLRQRIWKHVSDFHFRQWDLQLQJWKH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 P >'$7(@ WR >'$7(@ >'$7(@ WR >'$7(@ 1 2 Page: 36 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:25:00 AM -05'00' September 15 to May 15 Number: 2 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:24:02 AM -05'00' September 15 to May 15 0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( IXHOEXUQLQJHTXLSPHQWVKDOOEHSURYLGHGIRUWKHIXHOEXUQLQJ HTXLSPHQW (QHUJ\ FRQVHUYDWLRQ GHYLFHV 'HYLFHV LQWHQGHG WR UHGXFH IXHO FRQVXPSWLRQ E\ DWWDFKPHQW WR D IXHOEXUQLQJ DSSOLDQFHWRWKHIXHOVXSSO\OLQHWKHUHWRRUWRWKHYHQWRXWOHW RUYHQWSLSLQJWKHUHIURPVKDOOQRWEHLQVWDOOHGXQOHVVODEHOHG IRUVXFKSXUSRVHDQGWKHLQVWDOODWLRQLVVSHFLILFDOO\DSSURYHG 6(&7,21 (/(&75,&$/)$&,/,7,(6 )DFLOLWLHVUHTXLUHG(YHU\RFFXSLHGEXLOGLQJVKDOOEH SURYLGHGZLWKDQHOHFWULFDOV\VWHPLQFRPSOLDQFHZLWKWKH UHTXLUHPHQWVRIWKLVVHFWLRQDQG6HFWLRQ 6HUYLFH7KHVL]HDQGXVDJHRIDSSOLDQFHVDQGHTXLS PHQWVKDOOVHUYHDVDEDVLVIRUGHWHUPLQLQJWKHQHHGIRUDGGL WLRQDOIDFLOLWLHVLQDFFRUGDQFHZLWK1)3$'ZHOOLQJXQLWV VKDOOEHVHUYHGE\DWKUHHZLUHYROWVLQJOHSKDVH HOHFWULFDOVHUYLFHKDYLQJDPLQLPXPUDWLQJRIDPSHUHV (OHFWULFDOV\VWHPKD]DUGV:KHUHLWLVIRXQGWKDWWKH HOHFWULFDOV\VWHPLQ DVWUXFWXUHFRQVWLWXWHV D KD]DUGWR WKH RFFXSDQWVRUWKHVWUXFWXUHE\UHDVRQRILQDGHTXDWHVHUYLFH LPSURSHUIXVLQJLQVXIILFLHQWUHFHSWDFOHDQGOLJKWLQJRXWOHWV LPSURSHUZLULQJRULQVWDOODWLRQGHWHULRUDWLRQRUGDPDJHRU IRUVLPLODUUHDVRQVWKHFRGHRIILFLDOVKDOOUHTXLUHWKHGHIHFWV WREHFRUUHFWHGWRHOLPLQDWHWKHKD]DUG $EDWHPHQWRIHOHFWULFDOKD]DUGVDVVRFLDWHGZLWK ZDWHUH[SRVXUH7KHSURYLVLRQVRIWKLVVHFWLRQVKDOOJRY HUQWKHUHSDLUDQGUHSODFHPHQWRIHOHFWULFDOV\VWHPVDQG HTXLSPHQWWKDWKDYHEHHQH[SRVHGWRZDWHU (OHFWULFDO HTXLSPHQW (OHFWULFDO GLVWULEX WLRQHTXLSPHQWPRWRUFLUFXLWVSRZHUHTXLSPHQWWUDQV IRUPHUV ZLUH FDEOH IOH[LEOH FRUGV ZLULQJ GHYLFHV JURXQG IDXOW FLUFXLW LQWHUUXSWHUV VXUJH SURWHFWRUV PROGHGFDVHFLUFXLWEUHDNHUVORZYROWDJHIXVHVOXPL QDLUHVEDOODVWVPRWRUVDQGHOHFWURQLFFRQWUROVLJQDOLQJ DQGFRPPXQLFDWLRQHTXLSPHQWWKDWKDYHEHHQH[SRVHG WRZDWHUVKDOOEHUHSODFHGLQDFFRUGDQFHZLWKWKHSURYL VLRQVRIWKH,QWHUQDWLRQDO%XLOGLQJ&RGH ([FHSWLRQ 7KH IROORZLQJ HTXLSPHQW VKDOO EH DOORZHGWREHUHSDLUHGZKHUHDQLQVSHFWLRQUHSRUW IURPWKHHTXLSPHQWPDQXIDFWXUHURUDSSURYHGPDQ XIDFWXUHU¶VUHSUHVHQWDWLYHLQGLFDWHVWKDWWKH HTXLS PHQW KDV QRW VXVWDLQHG GDPDJH WKDW UHTXLUHV UHSODFHPHQW (QFORVHGVZLWFKHVUDWHGQRWPRUHWKDQ YROWVRUOHVV %XVZD\UDWHGQRWPRUHWKDQYROWV 3DQHOERDUGVUDWHGQRWPRUHWKDQYROWV 6ZLWFKERDUGVUDWHGQRWPRUHWKDQYROWV )LUHSXPSFRQWUROOHUVUDWHGQRWPRUHWKDQ YROWV 0DQXDODQGPDJQHWLFPRWRUFRQWUROOHUV 0RWRUFRQWUROFHQWHUV $OWHUQDWLQJ FXUUHQW KLJKYROWDJH FLUFXLW EUHDNHUV /RZYROWDJHSRZHUFLUFXLWEUHDNHUV 3URWHFWLYHUHOD\VPHWHUVDQGFXUUHQWWUDQV IRUPHUV /RZDQGPHGLXPYROWDJHVZLWFKJHDU /LTXLGILOOHGWUDQVIRUPHUV &DVWUHVLQWUDQVIRUPHUV :LUHRUFDEOHWKDWLVVXLWDEOHIRUZHWORFD WLRQVDQGZKRVHHQGVKDYHQRWEHHQH[SRVHG WRZDWHU :LUHRUFDEOHQRWFRQWDLQLQJILOOHUVWKDWLV VXLWDEOH IRU ZHW ORFDWLRQV DQG ZKRVH HQGV KDYHQRWEHHQH[SRVHGWRZDWHU /XPLQDLUHVWKDWDUHOLVWHGDVVXEPHUVLEOH 0RWRUV (OHFWURQLFFRQWUROVLJQDOLQJDQGFRPPXQL FDWLRQHTXLSPHQW $EDWHPHQWRIHOHFWULFDOKD]DUGVDVVRFLDWHGZLWK ILUHH[SRVXUH7KHSURYLVLRQVRIWKLVVHFWLRQVKDOOJRYHUQ WKHUHSDLUDQGUHSODFHPHQWRIHOHFWULFDOV\VWHPVDQGHTXLS PHQWWKDWKDYHEHHQH[SRVHGWRILUH (OHFWULFDO HTXLSPHQW (OHFWULFDO VZLWFKHV UHFHSWDFOHVDQGIL[WXUHVLQFOXGLQJIXUQDFHZDWHUKHDW LQJ VHFXULW\ V\VWHP DQG SRZHU GLVWULEXWLRQ FLUFXLWV WKDW KDYH EHHQ H[SRVHG WR ILUH VKDOO EH UHSODFHG LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI WKH,QWHUQDWLRQDO %XLOGLQJ&RGH ([FHSWLRQ(OHFWULFDOVZLWFKHVUHFHSWDFOHVDQGIL[ WXUHVWKDWVKDOOEHDOORZHGWREHUHSDLUHGZKHUHDQ LQVSHFWLRQUHSRUWIURPWKHHTXLSPHQWPDQXIDFWXUHU RUDSSURYHGPDQXIDFWXUHU¶VUHSUHVHQWDWLYHLQGLFDWHV WKDWWKHHTXLSPHQWKDVQRWVXVWDLQHGGDPDJHWKDW UHTXLUHVUHSODFHPHQW 6(&7,21 (/(&75,&$/(48,30(17 ,QVWDOODWLRQ(OHFWULFDOHTXLSPHQWZLULQJDQGDSSOL DQFHVVKDOOEHSURSHUO\LQVWDOOHGDQGPDLQWDLQHGLQDVDIHDQG DSSURYHGPDQQHU 5HFHSWDFOHV(YHU\KDELWDEOHVSDFHLQDGZHOOLQJVKDOO FRQWDLQQRWOHVVWKDQWZRVHSDUDWHDQGUHPRWHUHFHSWDFOHRXW OHWV (YHU\ ODXQGU\ DUHD VKDOO FRQWDLQ QRW OHVV WKDQ RQH JURXQGLQJW\SHUHFHSWDFOHRUDUHFHSWDFOHZLWKDJURXQGIDXOW FLUFXLWLQWHUUXSWHU(YHU\EDWKURRPVKDOOFRQWDLQQRWOHVVWKDQ RQH UHFHSWDFOH $Q\ QHZEDWKURRP UHFHSWDFOH RXWOHW VKDOO KDYHJURXQGIDXOWFLUFXLWLQWHUUXSWHUSURWHFWLRQ$OOUHFHSWDFOH RXWOHWVVKDOOKDYHWKHDSSURSULDWHIDFHSODWHFRYHUIRUWKHORFD WLRQ /XPLQDLUHV(YHU\SXEOLFKDOOLQWHULRUVWDLUZD\WRLOHW URRPNLWFKHQEDWKURRPODXQGU\URRPERLOHUURRPDQGIXU QDFHURRPVKDOOFRQWDLQQRWOHVVWKDQRQHHOHFWULFOXPLQDLUH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,,Q,WHUQDWLRQDO ,QWHUQDWLRQDO %XLOGLQJ &RGH 12 3 Page: 37 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:25:11 AM -05'00' MSBC Number: 2 Author: MPoehlman Date: 12/23/2019 2:38:17 PM Number: 3 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:25:43 AM -05'00' MSBC 0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 3RRODQGVSDOXPLQDLUHVRYHU9VKDOOKDYHJURXQGIDXOW FLUFXLWLQWHUUXSWHUSURWHFWLRQ :LULQJ)OH[LEOHFRUGVVKDOOQRWEHXVHGIRUSHUPDQHQW ZLULQJRUIRUUXQQLQJWKURXJKGRRUVZLQGRZVRUFDELQHWV RUFRQFHDOHGZLWKLQZDOOVIORRUVRUFHLOLQJV 6(&7,21 (/(9$7256(6&$/$7256$1''80%:$,7(56 *HQHUDO(OHYDWRUVGXPEZDLWHUVDQGHVFDODWRUVVKDOO EHPDLQWDLQHGLQFRPSOLDQFHZLWK$60($7KHPRVW FXUUHQW FHUWLILFDWH RI LQVSHFWLRQ VKDOO EH RQ GLVSOD\ DW DOO WLPHVZLWKLQWKHHOHYDWRURUDWWDFKHGWRWKHHVFDODWRURUGXPE ZDLWHUEHDYDLODEOHIRUSXEOLFLQVSHFWLRQLQWKHRIILFHRIWKH EXLOGLQJRSHUDWRU RU EH SRVWHG LQ D SXEOLFO\ FRQVSLFXRXV ORFDWLRQDSSURYHGE\WKHFRGHRIILFLDO7KHLQVSHFWLRQDQG WHVWVVKDOOEHSHUIRUPHGDWQRWOHVVWKDQWKHSHULRGLFLQWHUYDOV OLVWHGLQ$60($$SSHQGL[1H[FHSWZKHUHRWKHUZLVH VSHFLILHGE\WKHDXWKRULW\KDYLQJMXULVGLFWLRQ (OHYDWRUV,QEXLOGLQJVHTXLSSHGZLWKSDVVHQJHUHOHYD WRUVQRWOHVVWKDQRQHHOHYDWRUVKDOOEHPDLQWDLQHGLQRSHUD WLRQDWDOOWLPHVZKHQWKHEXLOGLQJLVRFFXSLHG ([FHSWLRQ %XLOGLQJV HTXLSSHG ZLWK RQO\ RQH HOHYDWRU VKDOOEHSHUPLWWHGWRKDYHWKHHOHYDWRUWHPSRUDULO\RXWRI VHUYLFHIRUWHVWLQJRUVHUYLFLQJ 6(&7,21 '8&76<67(06 *HQHUDO 'XFW V\VWHPV VKDOO EH PDLQWDLQHG IUHH RI REVWUXFWLRQVDQGVKDOOEHFDSDEOHRISHUIRUPLQJWKHUHTXLUHG IXQFWLRQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 ),5(6$)(7<5(48,5(0(176 User note: About this chapter:Chapter 7 establishes fire safety requirements for existing structures by containing requirements for means of egress, including path of travel, required egress width, means of egress doors and emergency escape openings, and for the maintenance of fire-resis- tance-rated assemblies, fire protection systems, and carbon monoxide alarm and detection systems. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPFRQGLWLRQVDQGVWDQGDUGVIRUILUHVDIHW\UHODWLQJWR VWUXFWXUHVDQGH[WHULRUSUHPLVHVLQFOXGLQJILUHVDIHW\IDFLOL WLHVDQGHTXLSPHQWWREHSURYLGHG 5HVSRQVLELOLW\7KHRZQHURIWKHSUHPLVHVVKDOOSUR YLGHDQGPDLQWDLQVXFKILUHVDIHW\IDFLOLWLHVDQGHTXLSPHQWLQ FRPSOLDQFH ZLWK WKHVH UHTXLUHPHQWV $ SHUVRQ VKDOO QRW RFFXS\ DVRZQHURFFXSDQW RU SHUPLW DQRWKHU SHUVRQ WR RFFXS\DQ\SUHPLVHVWKDWGRQRWFRPSO\ZLWKWKHUHTXLUH PHQWVRIWKLVFKDSWHU 6(&7,21 0($162)(*5(66 >)@*HQHUDO$VDIHFRQWLQXRXVDQGXQREVWUXFWHGSDWK RIWUDYHOVKDOOEHSURYLGHGIURPDQ\SRLQWLQDEXLOGLQJRU VWUXFWXUHWRWKHSXEOLFZD\0HDQVRIHJUHVVVKDOOFRPSO\ ZLWKWKH,QWHUQDWLRQDO)LUH&RGH >)@$LVOHV7KHUHTXLUHGZLGWKRIDLVOHVLQDFFRUGDQFH ZLWKWKH,QWHUQDWLRQDO)LUH&RGHVKDOOEHXQREVWUXFWHG >)@ /RFNHG GRRUV 0HDQV RI HJUHVV GRRUV VKDOO EH UHDGLO\RSHQDEOHIURPWKHVLGHIURPZKLFKHJUHVVLVWREH PDGHZLWKRXWWKHQHHGIRUNH\VVSHFLDONQRZOHGJHRUHIIRUW H[FHSWZKHUHWKHGRRUKDUGZDUHFRQIRUPVWRWKDWSHUPLWWHG E\WKH,QWHUQDWLRQDO%XLOGLQJ&RGH >)@(PHUJHQF\HVFDSHRSHQLQJV5HTXLUHGHPHUJHQF\ HVFDSHRSHQLQJVVKDOOEHPDLQWDLQHGLQDFFRUGDQFHZLWKWKH FRGHLQHIIHFWDWWKHWLPHRIFRQVWUXFWLRQDQGWKHIROORZLQJ 5HTXLUHG HPHUJHQF\ HVFDSH DQG UHVFXH RSHQLQJV VKDOO EH RSHUDWLRQDOIURPWKHLQVLGHRIWKHURRPZLWKRXWWKHXVHRI NH\VRUWRROV%DUVJULOOHVJUDWHVRUVLPLODUGHYLFHVDUHSHU PLWWHGWREHSODFHGRYHUHPHUJHQF\HVFDSHDQGUHVFXHRSHQ LQJV SURYLGHG WKDW WKH PLQLPXP QHW FOHDU RSHQLQJ VL]H FRPSOLHVZLWKWKHFRGHWKDWZDVLQHIIHFWDWWKHWLPHRIFRQ VWUXFWLRQDQGVXFKGHYLFHVVKDOOEHUHOHDVDEOHRUUHPRYDEOH IURPWKHLQVLGHZLWKRXWWKHXVHRIDNH\WRRORUIRUFHJUHDWHU WKDQWKDWZKLFKLVUHTXLUHGIRUQRUPDORSHUDWLRQRIWKHHVFDSH DQGUHVFXHRSHQLQJ 6(&7,21 ),5(5(6,67$1&(5$7,1*6 >)@)LUHUHVLVWDQFHUDWHGDVVHPEOLHV7KHSURYLVLRQV RIWKLVFKDSWHUVKDOOJRYHUQPDLQWHQDQFHRIWKHPDWHULDOVV\V WHPVDQGDVVHPEOLHVXVHGIRUVWUXFWXUDOILUHUHVLVWDQFHDQG ILUHUHVLVWDQFHUDWHG FRQVWUXFWLRQ VHSDUDWLRQ RI DGMDFHQW VSDFHV WR VDIHJXDUG DJDLQVW WKH VSUHDG RI ILUH DQG VPRNH ZLWKLQDEXLOGLQJDQGWKHVSUHDGRIILUHWRRUIURPEXLOGLQJV >)@8QVDIHFRQGLWLRQV:KHUHDQ\FRPSRQHQWVDUHQRW PDLQWDLQHGDQGGRQRWIXQFWLRQDVLQWHQGHGRUGRQRWKDYHWKH ILUHUHVLVWDQFHUHTXLUHGE\WKHFRGHXQGHUZKLFKWKHEXLOGLQJ ZDV FRQVWUXFWHG RU DOWHUHG VXFK FRPSRQHQWV RU SRUWLRQV WKHUHRIVKDOOEHGHHPHGXQVDIHFRQGLWLRQVLQDFFRUGDQFHZLWK 6HFWLRQRIWKH,QWHUQDWLRQDO)LUH&RGH&RPSRQHQWV RUSRUWLRQVWKHUHRIGHWHUPLQHGWREHXQVDIHVKDOOEHUHSDLUHG RUUHSODFHGWRFRQIRUPWRWKDWFRGHXQGHUZKLFKWKHEXLOGLQJ ZDVFRQVWUXFWHGRUDOWHUHG:KHUHWKHFRQGLWLRQRIFRPSR QHQWVLVVXFKWKDWDQ\EXLOGLQJVWUXFWXUHRUSRUWLRQWKHUHRI SUHVHQWVDQLPPLQHQWGDQJHUWRWKHRFFXSDQWVRIWKHEXLOGLQJ VWUXFWXUHRUSRUWLRQWKHUHRIWKHILUHFRGHRIILFLDOVKDOODFWLQ DFFRUGDQFH ZLWK 6HFWLRQ RI WKH,QWHUQDWLRQDO )LUH &RGH >)@0DLQWHQDQFH7KHUHTXLUHGILUHUHVLVWDQFHUDWLQJ RI ILUHUHVLVWDQFHUDWHG FRQVWUXFWLRQ LQFOXGLQJ ZDOOV ILUHVWRSVVKDIWHQFORVXUHVSDUWLWLRQVVPRNHEDUULHUVIORRUV ILUHUHVLVWLYH FRDWLQJV DQG VSUD\HG ILUHUHVLVWDQW PDWHULDOV DSSOLHG WR VWUXFWXUDO PHPEHUV DQG MRLQW V\VWHPV VKDOO EH PDLQWDLQHG6XFKHOHPHQWVVKDOOEHYLVXDOO\LQVSHFWHGDQQX DOO\E\WKHRZQHUDQGUHSDLUHGUHVWRUHGRUUHSODFHGZKHUH GDPDJHGDOWHUHGEUHDFKHGRUSHQHWUDWHG5HFRUGVRILQVSHF WLRQVDQGUHSDLUVVKDOOEHPDLQWDLQHG:KHUHFRQFHDOHGVXFK HOHPHQWVVKDOOQRWEHUHTXLUHGWREHYLVXDOO\LQVSHFWHGE\WKH RZQHU XQOHVV WKH FRQFHDOHG VSDFH LV DFFHVVLEOH E\ WKH UHPRYDORUPRYHPHQWRIDSDQHODFFHVVGRRUFHLOLQJWLOHRU HQWU\WRWKHVSDFH2SHQLQJVPDGHWKHUHLQIRUWKHSDVVDJHRI SLSHVHOHFWULFDOFRQGXLWZLUHV GXFWVDLUWUDQVIHUDQGDQ\ RWKHUUHDVRQVKDOOEHSURWHFWHGZLWKDSSURYHGPHWKRGVFDSD EOH RI UHVLVWLQJ WKH SDVVDJH RI VPRNH DQG ILUH 2SHQLQJV WKURXJKILUHUHVLVWDQFHUDWHGDVVHPEOLHVVKDOOEHSURWHFWHGE\ VHOI RU DXWRPDWLFFORVLQJ GRRUV RI DSSURYHG FRQVWUXFWLRQ PHHWLQJWKHILUHSURWHFWLRQUHTXLUHPHQWVIRUWKHDVVHPEO\ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,QWHUQDWLRQDO %XLOGLQJ &RGH 1 Page: 40 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:25:58 AM -05'00' MSBC ),5(6$)(7<5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( >)@)LUHEORFNLQJDQGGUDIWVWRSSLQJ5HTXLUHG ILUHEORFNLQJDQGGUDIWVWRSSLQJLQFRPEXVWLEOHFRQFHDOHG VSDFHVVKDOOEHPDLQWDLQHGWRSURYLGHFRQWLQXLW\DQGLQWHJ ULW\RIWKHFRQVWUXFWLRQ >)@ 6PRNH EDUULHUV DQG VPRNH SDUWLWLRQV 5HTXLUHG VPRNH EDUULHUV DQG VPRNH SDUWLWLRQV VKDOO EH PDLQWDLQHG WR SUHYHQW WKH SDVVDJH RI VPRNH 2SHQLQJV SURWHFWHG ZLWK DSSURYHG VPRNH EDUULHU GRRUV RU VPRNH GDPSHUVVKDOO EH PDLQWDLQHGLQDFFRUGDQFHZLWK1)3$ >)@)LUHZDOOVILUHEDUULHUVDQGILUHSDUWLWLRQV 5HTXLUHGILUHZDOOVILUHEDUULHUVDQGILUHSDUWLWLRQVVKDOOEH PDLQWDLQHGWRSUHYHQWWKHSDVVDJHRIILUH2SHQLQJVSUR WHFWHGZLWKDSSURYHGGRRUVRUILUHGDPSHUVVKDOOEHPDLQ WDLQHGLQDFFRUGDQFHZLWK1)3$ >)@2SHQLQJSURWHFWLYHV2SHQLQJSURWHFWLYHVVKDOOEH PDLQWDLQHG LQ DQ RSHUDWLYH FRQGLWLRQ LQ DFFRUGDQFH ZLWK 1)3$7KHDSSOLFDWLRQRIILHOGDSSOLHGODEHOVDVVRFLDWHG ZLWKWKHPDLQWHQDQFHRIRSHQLQJSURWHFWLYHVVKDOOIROORZWKH UHTXLUHPHQWVRIWKHDSSURYHGWKLUGSDUW\FHUWLILFDWLRQRUJDQL ]DWLRQDFFUHGLWHGIRUOLVWLQJWKHRSHQLQJSURWHFWLYH)LUHGRRUV DQGVPRNHEDUULHUGRRUVVKDOOQRWEHEORFNHGRUREVWUXFWHGRU RWKHUZLVHPDGHLQRSHUDEOH)XVLEOHOLQNVVKDOOEHUHSODFHG ZKHQHYHUIXVHGRUGDPDJHG)LUHGRRUDVVHPEOLHVVKDOOQRW EHPRGLILHG >)@6LJQV:KHUHUHTXLUHGE\WKHFRGHRIILFLDOD VLJQVKDOOEHSHUPDQHQWO\GLVSOD\HGRQRUQHDUHDFKILUH GRRULQOHWWHUVQRWOHVVWKDQLQFKPPKLJKWRUHDGDV IROORZV )RUGRRUVGHVLJQHGWREHNHSWQRUPDOO\RSHQ),5( '225±'2127%/2&. )RU GRRUV GHVLJQHG WR EH NHSW QRUPDOO\ FORVHG ),5('225±.((3&/26(' >)@+ROGRSHQGHYLFHVDQGFORVHUV+ROGRSHQ GHYLFHVDQGDXWRPDWLFGRRUFORVHUVVKDOOEHPDLQWDLQHG 'XULQJWKHSHULRGWKDWVXFKDGHYLFHLVRXWRIVHUYLFHIRU UHSDLUVWKHGRRULWRSHUDWHVVKDOOUHPDLQLQWKHFORVHGSRVL WLRQ >)@ 'RRU RSHUDWLRQ 6ZLQJLQJ ILUH GRRUV VKDOO FORVHIURPWKHIXOORSHQSRVLWLRQDQGODWFKDXWRPDWLFDOO\ 7KHGRRUFORVHUVKDOOH[HUWHQRXJKIRUFHWRFORVHDQGODWFK WKHGRRUIURPDQ\SDUWLDOO\RSHQSRVLWLRQ >)@&HLOLQJV7KHKDQJLQJDQGGLVSOD\LQJRIVDODEOH JRRGVDQGRWKHUGHFRUDWLYHPDWHULDOVIURPDFRXVWLFDOFHLOLQJ V\VWHPV WKDW DUH SDUW RI D ILUHUHVLVWDQFHUDWHG KRUL]RQWDO DVVHPEO\VKDOOEHSURKLELWHG >)@7HVWLQJ+RUL]RQWDODQGYHUWLFDOVOLGLQJDQGUROOLQJ ILUHGRRUVVKDOOEHLQVSHFWHGDQGWHVWHGDQQXDOO\WRFRQILUP RSHUDWLRQDQGIXOOFORVXUH5HFRUGVRILQVSHFWLRQVDQGWHVWLQJ VKDOOEHPDLQWDLQHG >)@9HUWLFDOVKDIWV,QWHULRUYHUWLFDOVKDIWVLQFOXGLQJ VWDLUZD\VHOHYDWRUKRLVWZD\VDQGVHUYLFHDQGXWLOLW\VKDIWV ZKLFK FRQQHFW WZR RU PRUH VWRULHV RI D EXLOGLQJ VKDOO EH HQFORVHGRUSURWHFWHGDVUHTXLUHGLQ&KDSWHURIWKH,QWHU QDWLRQDO)LUH&RGH1HZIORRURSHQLQJVLQH[LVWLQJEXLOGLQJV VKDOOFRPSO\ZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH >)@2SHQLQJSURWHFWLYHFORVHUV:KHUHRSHQLQJVDUH UHTXLUHGWREHSURWHFWHGRSHQLQJSURWHFWLYHVVKDOOEHPDLQ WDLQHGVHOIFORVLQJRUDXWRPDWLFFORVLQJE\VPRNHGHWHFWLRQ ([LVWLQJ IXVLEOHOLQNW\SH DXWRPDWLF GRRUFORVLQJ GHYLFHV VKDOO EH UHSODFHG LI WKH IXVLEOH OLQN UDWLQJ H[FHHGV ) & 6(&7,21 ),5(3527(&7,216<67(06 >)@,QVSHFWLRQWHVWLQJDQGPDLQWHQDQFH)LUHGHWHF WLRQ DODUP DQG H[WLQJXLVKLQJ V\VWHPV PHFKDQLFDO VPRNH H[KDXVWV\VWHPVDQGVPRNHDQGKHDWYHQWVVKDOOEHPDLQ WDLQHGLQDFFRUGDQFHZLWKWKH,QWHUQDWLRQDO)LUH&RGHLQDQ RSHUDWLYH FRQGLWLRQ DW DOO WLPHV DQG VKDOO EH UHSODFHG RU UHSDLUHGZKHUHGHIHFWLYH >)@,QVWDOODWLRQ)LUHSURWHFWLRQV\VWHPVVKDOOEH PDLQWDLQHG LQ DFFRUGDQFH ZLWK WKH RULJLQDO LQVWDOODWLRQ VWDQGDUGV IRU WKDW V\VWHP 5HTXLUHG V\VWHPV VKDOO EH H[WHQGHGDOWHUHGRUDXJPHQWHGDVQHFHVVDU\WRPDLQWDLQ DQGFRQWLQXHSURWHFWLRQZKHUHWKHEXLOGLQJLVDOWHUHGRU HQODUJHG$OWHUDWLRQVWRILUHSURWHFWLRQV\VWHPVVKDOOEH GRQHLQDFFRUGDQFHZLWKDSSOLFDEOHVWDQGDUGV >)@5HTXLUHGILUHSURWHFWLRQV\VWHPV)LUHSUR WHFWLRQV\VWHPVUHTXLUHGE\WKLVFRGHWKH,QWHUQDWLRQDO )LUH &RGHRUWKH,QWHUQDWLRQDO %XLOGLQJ &RGHVKDOOEH LQVWDOOHG UHSDLUHG RSHUDWHG WHVWHG DQG PDLQWDLQHG LQ DFFRUGDQFHZLWKWKLVFRGH$ILUHSURWHFWLRQV\VWHPIRU ZKLFKDGHVLJQRSWLRQH[FHSWLRQRUUHGXFWLRQWRWKHSURYL VLRQVRIWKLVFRGHWKH,QWHUQDWLRQDO)LUH&RGHRUWKH,QWHU QDWLRQDO %XLOGLQJ &RGH KDV EHHQ JUDQWHG VKDOO EH FRQVLGHUHGWREHDUHTXLUHGV\VWHP >)@)LUHSURWHFWLRQV\VWHPV)LUHSURWHFWLRQV\V WHPVVKDOOEHLQVSHFWHGPDLQWDLQHGDQGWHVWHGLQDFFRU GDQFH ZLWK WKH IROORZLQJ,QWHUQDWLRQDO )LUH &RGH UHTXLUHPHQWV $XWRPDWLFVSULQNOHUV\VWHPVVHH6HFWLRQ $XWRPDWLF ILUHH[WLQJXLVKLQJ V\VWHPV SURWHFWLQJ FRPPHUFLDOFRRNLQJV\VWHPVVHH6HFWLRQ $XWRPDWLFZDWHUPLVWH[WLQJXLVKLQJV\VWHPVVHH 6HFWLRQ &DUERQGLR[LGHH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ &DUERQ PRQR[LGH DODUPV DQG FDUERQ PRQR[LGH GHWHFWLRQV\VWHPVVHH6HFWLRQ &OHDQDJHQW H[WLQJXLVKLQJ V\VWHPV VHH 6HFWLRQ 'U\FKHPLFDOH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ )LUHDODUPDQGILUHGHWHFWLRQV\VWHPVVHH6HFWLRQ )LUHGHSDUWPHQWFRQQHFWLRQVVHH6HFWLRQV DQG )LUHSXPSVVHH6HFWLRQ )RDPH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ +DORQH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 Page: 41 Number: 1 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 2:40:05 PM ),5(6$)(7<5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 6LQJOH DQG PXOWLSOHVWDWLRQ VPRNH DODUPV VHH 6HFWLRQ 6PRNH DQG KHDW YHQWV DQG PHFKDQLFDO VPRNH UHPRYDOV\VWHPVVHH6HFWLRQ 6PRNHFRQWUROV\VWHPVVHH6HFWLRQ :HWFKHPLFDOH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ >)@ 6WDQGDUGV )LUH SURWHFWLRQ V\VWHPV VKDOO EH LQVSHFWHGWHVWHGDQGPDLQWDLQHGLQDFFRUGDQFHZLWKWKHUHIHU HQFHGVWDQGDUGVOLVWHGLQ7DEOHDQGDVUHTXLUHGLQWKLV VHFWLRQ 7$%/( ),5(3527(&7,216<67(00$,17(1$1&(67$1'$5'6 >)@5HFRUGV5HFRUGVVKDOOEHPDLQWDLQHGRIDOO V\VWHPLQVSHFWLRQVWHVWVDQGPDLQWHQDQFHUHTXLUHGE\WKH UHIHUHQFHGVWDQGDUGV >)@ 5HFRUGV LQIRUPDWLRQ ,QLWLDO UHFRUGV VKDOO LQFOXGHWKHQDPHRIWKHLQVWDOODWLRQFRQWUDFWRUW\SHRI FRPSRQHQWV LQVWDOOHG PDQXIDFWXUHU RI WKH FRPSRQHQWV ORFDWLRQDQGQXPEHU RIFRPSRQHQWVLQVWDOOHG SHUIORRU DQGPDQXIDFWXUHUV¶RSHUDWLRQDQGPDLQWHQDQFHLQVWUXFWLRQ PDQXDOV6XFKUHFRUGVVKDOOEHPDLQWDLQHGIRUWKHOLIHRI WKHLQVWDOODWLRQ >)@6\VWHPVRXWRIVHUYLFH:KHUHDUHTXLUHGILUHSUR WHFWLRQV\VWHPLVRXWRIVHUYLFHWKHILUHGHSDUWPHQWDQGWKH ILUHFRGHRIILFLDOVKDOOEHQRWLILHGLPPHGLDWHO\DQGZKHUH UHTXLUHGE\WKHILUHFRGHRIILFLDOHLWKHUWKHEXLOGLQJVKDOOEH HYDFXDWHGRUDQDSSURYHGILUHZDWFKVKDOOEHSURYLGHGIRUDOO RFFXSDQWVOHIWXQSURWHFWHGE\WKHVKXWGRZQXQWLOWKHILUHSUR WHFWLRQV\VWHPKDVEHHQUHWXUQHGWRVHUYLFH:KHUHXWLOL]HG ILUH ZDWFKHV VKDOO EH SURYLGHG ZLWK QRW OHVV WKDQ RQH DSSURYHGPHDQVIRUQRWLILFDWLRQRIWKHILUHGHSDUWPHQWDQG VKDOOQRWKDYHGXWLHVEH\RQGSHUIRUPLQJFRQVWDQWSDWUROVRI WKHSURWHFWHGSUHPLVHVDQGNHHSLQJZDWFKIRUILUHV$FWLRQV VKDOOEHWDNHQLQDFFRUGDQFHZLWK6HFWLRQRIWKH,QWHUQD WLRQDO)LUH&RGHWREULQJWKHV\VWHPVEDFNLQVHUYLFH >)@(PHUJHQF\LPSDLUPHQWV:KHUHXQSODQQHG LPSDLUPHQWVRIILUHSURWHFWLRQV\VWHPVRFFXUDSSURSULDWH HPHUJHQF\ DFWLRQ VKDOO EH WDNHQ WR PLQLPL]H SRWHQWLDO LQMXU\ DQG GDPDJH 7KH LPSDLUPHQW FRRUGLQDWRU VKDOO LPSOHPHQW WKH VWHSV RXWOLQHG LQ 6HFWLRQ RI WKH ,QWHUQDWLRQDO)LUH&RGH >)@ 5HPRYDO RI RU WDPSHULQJ ZLWK HTXLSPHQW,W VKDOOEHXQODZIXOIRUDQ\SHUVRQWRUHPRYHWDPSHUZLWKRU RWKHUZLVHGLVWXUEDQ\ILUHK\GUDQWILUHGHWHFWLRQDQGDODUP V\VWHP ILUH VXSSUHVVLRQ V\VWHP RU RWKHU ILUH DSSOLDQFH UHTXLUHGE\WKLVFRGHH[FHSWIRUWKHSXUSRVHVRIH[WLQJXLVKLQJ ILUHWUDLQLQJUHFKDUJLQJRUPDNLQJQHFHVVDU\UHSDLUV >)@ 5HPRYDO RI RU WDPSHULQJ ZLWK DSSXUWH QDQFHV /RFNV JDWHV GRRUV EDUULFDGHV FKDLQV HQFOR VXUHVVLJQVWDJVDQGVHDOVWKDWKDYHEHHQLQVWDOOHGE\RUDW WKHGLUHFWLRQRIWKHILUHFRGHRIILFLDOVKDOOQRWEHUHPRYHG XQORFNHGGHVWUR\HGRUWDPSHUHGZLWKLQDQ\PDQQHU >)@ 5HPRYDO RI H[LVWLQJ RFFXSDQWXVH KRVH OLQHV7KHILUHFRGHRIILFLDOLVDXWKRUL]HGWRSHUPLWWKH UHPRYDORIH[LVWLQJRFFXSDQWXVHKRVHOLQHVZKHUHDOORI WKHIROORZLQJDSSO\ 7KHLQVWDOODWLRQLVQRWUHTXLUHGE\WKH,QWHUQDWLRQDO )LUH&RGHRUWKH,QWHUQDWLRQDO%XLOGLQJ&RGH 7KHKRVHOLQHZRXOGQRWEHXWLOL]HGE\WUDLQHGSHU VRQQHORUWKHILUHGHSDUWPHQW 7KHUHPDLQLQJRXWOHWVDUHFRPSDWLEOHZLWKORFDOILUH GHSDUWPHQWILWWLQJV >)@7HUPLQDWLRQRIPRQLWRULQJVHUYLFH)RUILUH DODUPV\VWHPVUHTXLUHGWREHPRQLWRUHGE\WKH,QWHUQD WLRQDO)LUH&RGHQRWLFHVKDOOEHPDGHWRWKHILUHFRGHRIIL FLDOZKHQHYHUDODUPPRQLWRULQJVHUYLFHVDUHWHUPLQDWHG 1RWLFHVKDOOEHPDGHLQZULWLQJE\WKHSURYLGHURIWKH PRQLWRULQJVHUYLFHEHLQJWHUPLQDWHG >)@ )LUH GHSDUWPHQW FRQQHFWLRQ :KHUH WKH ILUH GHSDUWPHQW FRQQHFWLRQ LV QRW YLVLEOH WR DSSURDFKLQJ ILUH DSSDUDWXVWKHILUHGHSDUWPHQWFRQQHFWLRQVKDOOEHLQGLFDWHG E\DQDSSURYHGVLJQPRXQWHGRQWKHVWUHHWIURQWRURQWKHVLGH RIWKHEXLOGLQJ6XFKVLJQVKDOOKDYHWKHOHWWHUV³)'&´QRW OHVVWKDQLQFKHVPPKLJKDQGZRUGVLQOHWWHUVQRWOHVV WKDQLQFKHVPPKLJKRUDQDUURZWRLQGLFDWHWKHORFD WLRQ6XFKVLJQVVKDOOEHVXEMHFWWRWKHDSSURYDORIWKHILUH FRGHRIILFLDO >)@ )LUH GHSDUWPHQW FRQQHFWLRQ DFFHVV5HDG\ DFFHVVWRILUHGHSDUWPHQWFRQQHFWLRQVVKDOOEHPDLQWDLQHGDW DOOWLPHVDQGZLWKRXWREVWUXFWLRQE\IHQFHVEXVKHVWUHHV ZDOOVRUDQ\RWKHUIL[HGRUPRYDEOHREMHFW$FFHVVWRILUH GHSDUWPHQWFRQQHFWLRQVVKDOOEHDSSURYHGE\WKHILUHFKLHI ([FHSWLRQ)HQFHVZKHUHSURYLGHGZLWKDQDFFHVVJDWH HTXLSSHG ZLWK D VLJQ FRPSO\LQJ ZLWK WKH OHJHQG UHTXLUHPHQWVRI6HFWLRQRIWKH,QWHUQDWLRQDO)LUH &RGHDQGDPHDQVRIHPHUJHQF\RSHUDWLRQ7KHJDWH DQG WKH PHDQV RI HPHUJHQF\ RSHUDWLRQ VKDOO EH DSSURYHGE\WKHILUHFKLHIDQGPDLQWDLQHGRSHUDWLRQDO DWDOOWLPHV >)@&OHDUVSDFHDURXQGFRQQHFWLRQV$ZRUNLQJ VSDFHRIQRWOHVVWKDQLQFKHVPPLQZLGWK LQFKHVPPLQGHSWKDQGLQFKHVPPLQ KHLJKWVKDOOEHSURYLGHGDQGPDLQWDLQHGLQIURQWRIDQGWR WKHVLGHVRIZDOOPRXQWHGILUHGHSDUWPHQWFRQQHFWLRQVDQG DURXQGWKHFLUFXPIHUHQFHRIIUHHVWDQGLQJILUHGHSDUWPHQW FRQQHFWLRQV 6<67(0 67$1'$5' 3RUWDEOHILUHH[WLQJXLVKHUV 1)3$ &DUERQGLR[LGHILUHH[WLQJXLVKLQJV\VWHP 1)3$ +DORQILUHH[WLQJXLVKLQJV\VWHPV 1)3$$ 'U\FKHPLFDOH[WLQJXLVKLQJV\VWHPV 1)3$ :HWFKHPLFDOH[WLQJXLVKLQJV\VWHPV 1)3$$ :DWHUEDVHGILUHSURWHFWLRQV\VWHPV 1)3$ )LUHDODUPV\VWHPV 1)3$ 6PRNHDQGKHDWYHQWV 1)3$ :DWHUPLVWV\VWHPV 1)3$ &OHDQDJHQWH[WLQJXLVKLQJV\VWHPV 1)3$ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ),5(6$)(7<5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( >)@6LQJOHDQGPXOWLSOHVWDWLRQVPRNHDODUPV6LQ JOHDQGPXOWLSOHVWDWLRQVPRNHDODUPVVKDOOEHLQVWDOOHGLQ H[LVWLQJ *URXS , DQG 5 RFFXSDQFLHV LQ DFFRUGDQFH ZLWK 6HFWLRQVWKURXJK >)@:KHUHUHTXLUHG([LVWLQJ*URXS,DQG5 RFFXSDQFLHVVKDOOEHSURYLGHGZLWKVLQJOHVWDWLRQVPRNH DODUPV LQ DFFRUGDQFH ZLWK 6HFWLRQV WKURXJK ,QWHUFRQQHFWLRQDQGSRZHUVRXUFHVVKDOOEHLQ DFFRUGDQFHZLWK6HFWLRQVDQG ([FHSWLRQV :KHUHWKHFRGHWKDWZDVLQHIIHFWDWWKHWLPHRI FRQVWUXFWLRQUHTXLUHGVPRNHDODUPVDQGVPRNH DODUPV FRPSO\LQJ ZLWK WKRVH UHTXLUHPHQWV DUH DOUHDG\SURYLGHG :KHUHVPRNHDODUPVKDYHEHHQLQVWDOOHGLQRFFX SDQFLHVDQGGZHOOLQJVWKDWZHUHQRWUHTXLUHGWR KDYHWKHPDWWKHWLPHRIFRQVWUXFWLRQDGGLWLRQDO VPRNHDODUPVVKDOOQRWEHUHTXLUHGSURYLGHGWKDW WKHH[LVWLQJVPRNHDODUPVFRPSO\ZLWKUHTXLUH PHQWVWKDWZHUHLQHIIHFWDWWKHWLPHRILQVWDOOD WLRQ :KHUHVPRNHGHWHFWRUVFRQQHFWHGWRDILUHDODUP V\VWHP KDYH EHHQ LQVWDOOHG DV D VXEVWLWXWH IRU VPRNHDODUPV >)@*URXS56LQJOHRUPXOWLSOHVWDWLRQ VPRNHDODUPVVKDOOEHLQVWDOOHGLQDOORIWKHIROORZLQJ ORFDWLRQVLQ*URXS5 ,QVOHHSLQJDUHDV ,QHYHU\URRPLQWKHSDWKRIWKHPHDQVRIHJUHVV IURPWKHVOHHSLQJDUHDWRWKHGRRUOHDGLQJIURP WKHVOHHSLQJXQLW ,QHDFKVWRU\ZLWKLQWKHVOHHSLQJXQLWLQFOXGLQJ EDVHPHQWV )RUVOHHSLQJ XQLWV ZLWK VSOLW OHYHOV DQG ZLWKRXW DQ LQWHUYHQLQJ GRRU EHWZHHQ WKH DGMDFHQWOHYHOVDVPRNHDODUPLQVWDOOHGRQWKH XSSHUOHYHOVKDOOVXIILFHIRUWKHDGMDFHQWORZHU OHYHOSURYLGHGWKDWWKHORZHUOHYHOLVOHVVWKDQRQH IXOOVWRU\EHORZWKHXSSHUOHYHO >)@*URXSV555DQG,6LQJOH RUPXOWLSOHVWDWLRQVPRNHDODUPVVKDOOEHLQVWDOOHGDQG PDLQWDLQHGLQ*URXSV555DQG,UHJDUGOHVV RIRFFXSDQWORDGDWDOORIWKHIROORZLQJORFDWLRQV 2QWKHFHLOLQJRUZDOORXWVLGHRIHDFKVHSDUDWH VOHHSLQJDUHDLQWKHLPPHGLDWHYLFLQLW\RIEHG URRPV ,QHDFKURRPXVHGIRUVOHHSLQJSXUSRVHV ,QHDFKVWRU\ZLWKLQDGZHOOLQJXQLWLQFOXGLQJ EDVHPHQWV EXW QRW LQFOXGLQJ FUDZO VSDFHV DQG XQLQKDELWDEOH DWWLFV ,QGZHOOLQJVRUGZHOOLQJ XQLWVZLWKVSOLWOHYHOVDQGZLWKRXWDQLQWHUYHQLQJ GRRUEHWZHHQWKHDGMDFHQWOHYHOVDVPRNHDODUP LQVWDOOHGRQWKHXSSHUOHYHOVKDOOVXIILFHIRUWKH DGMDFHQWORZHUOHYHOSURYLGHGWKDWWKHORZHUOHYHO LVOHVVWKDQRQHIXOOVWRU\EHORZWKHXSSHUOHYHO >)@ ,QVWDOODWLRQ QHDU FRRNLQJ DSSOLDQFHV 6PRNHDODUPVVKDOOQRWEHLQVWDOOHGLQWKHIROORZLQJ ORFDWLRQV XQOHVV WKLV ZRXOG SUHYHQW SODFHPHQW RI D VPRNH DODUP LQ D ORFDWLRQ UHTXLUHG E\ 6HFWLRQ RU ,RQL]DWLRQ VPRNH DODUPV VKDOO QRW EH LQVWDOOHG OHVVWKDQIHHWPKRUL]RQWDOO\IURPD SHUPDQHQWO\LQVWDOOHGFRRNLQJDSSOLDQFH ,RQL]DWLRQVPRNHDODUPVZLWKDQDODUPVLOHQFLQJ VZLWFK VKDOO QRW EH LQVWDOOHG OHVV WKDQ IHHW PP KRUL]RQWDOO\ IURP D SHUPDQHQWO\ LQVWDOOHGFRRNLQJDSSOLDQFH 3KRWRHOHFWULFVPRNHDODUPVVKDOOQRWEHLQVWDOOHG OHVVWKDQIHHWPPKRUL]RQWDOO\IURPD SHUPDQHQWO\LQVWDOOHGFRRNLQJDSSOLDQFH >)@ ,QVWDOODWLRQ QHDU EDWKURRPV6PRNH DODUPVVKDOOEHLQVWDOOHGQRWOHVVWKDQIHHWPP KRUL]RQWDOO\IURPWKHGRRURURSHQLQJRIDEDWKURRP WKDWFRQWDLQVDEDWKWXERUVKRZHUXQOHVVWKLVZRXOGSUH YHQWSODFHPHQWRIDVPRNHDODUPUHTXLUHGE\6HFWLRQ RU >)@,QWHUFRQQHFWLRQ:KHUHPRUHWKDQRQHVPRNH DODUP LV UHTXLUHG WR EH LQVWDOOHG ZLWKLQ DQ LQGLYLGXDO GZHOOLQJRUVOHHSLQJXQLWWKHVPRNHDODUPVVKDOOEHLQWHU FRQQHFWHG LQ VXFK D PDQQHU WKDW WKH DFWLYDWLRQ RI RQH DODUPZLOODFWLYDWHDOORIWKHDODUPVLQWKHLQGLYLGXDOXQLW 3K\VLFDO LQWHUFRQQHFWLRQ RI VPRNH DODUPV VKDOO QRW EH UHTXLUHGZKHUHOLVWHGZLUHOHVVDODUPVDUHLQVWDOOHGDQGDOO DODUPV VRXQG XSRQ DFWLYDWLRQ RI RQH DODUP 7KH DODUP VKDOOEHFOHDUO\DXGLEOHLQDOOEHGURRPVRYHUEDFNJURXQG QRLVHOHYHOVZLWKDOOLQWHUYHQLQJGRRUVFORVHG ([FHSWLRQV ,QWHUFRQQHFWLRQLVQRWUHTXLUHGLQEXLOGLQJVWKDW DUH QRW XQGHUJRLQJDOWHUDWLRQV UHSDLUV RU FRQ VWUXFWLRQRIDQ\NLQG 6PRNHDODUPVLQH[LVWLQJDUHDVDUHQRWUHTXLUHG WREHLQWHUFRQQHFWHGZKHUHDOWHUDWLRQVRUUHSDLUV GRQRWUHVXOWLQWKHUHPRYDORILQWHULRUZDOORU FHLOLQJ ILQLVKHV H[SRVLQJ WKH VWUXFWXUH XQOHVV WKHUHLVDQDWWLFFUDZOVSDFHRUEDVHPHQWDYDLO DEOHWKDWFRXOGSURYLGHDFFHVVIRULQWHUFRQQHFWLRQ ZLWKRXWWKHUHPRYDORILQWHULRUILQLVKHV >)@3RZHUVRXUFH6LQJOHVWDWLRQVPRNHDODUPV VKDOOUHFHLYHWKHLUSULPDU\SRZHUIURPWKHEXLOGLQJZLULQJ SURYLGHGWKDWVXFKZLULQJLVVHUYHGIURPDFRPPHUFLDO VRXUFH DQG VKDOO EH HTXLSSHG ZLWK D EDWWHU\ EDFNXS 6PRNHDODUPVZLWKLQWHJUDOVWUREHVWKDWDUHQRWHTXLSSHG ZLWKEDWWHU\EDFNXSVKDOOEHFRQQHFWHGWRDQHPHUJHQF\ HOHFWULFDOV\VWHP6PRNHDODUPVVKDOOHPLWDVLJQDOZKHQ WKHEDWWHULHVDUHORZ:LULQJVKDOOEHSHUPDQHQWDQGZLWK RXWDGLVFRQQHFWLQJVZLWFKRWKHUWKDQDVUHTXLUHGIRURYHU FXUUHQWSURWHFWLRQ ([FHSWLRQV 6PRNHDODUPVDUHSHUPLWWHGWREHVROHO\EDWWHU\ RSHUDWHGLQH[LVWLQJEXLOGLQJVZKHUHFRQVWUXFWLRQ LVQRWWDNLQJSODFH 6PRNHDODUPVDUHSHUPLWWHGWREHVROHO\EDWWHU\ RSHUDWHGLQEXLOGLQJVWKDWDUHQRWVHUYHGIURPD FRPPHUFLDOSRZHUVRXUFH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ),5(6$)(7<5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 6PRNHDODUPVDUHSHUPLWWHGWREHVROHO\EDWWHU\ RSHUDWHGLQH[LVWLQJDUHDVRIEXLOGLQJVXQGHUJR LQJDOWHUDWLRQVRUUHSDLUVWKDWGRQRWUHVXOWLQWKH UHPRYDO RI LQWHULRU ZDOOV RU FHLOLQJ ILQLVKHV H[SRVLQJWKHVWUXFWXUH XQOHVVWKHUHLVDQDWWLF FUDZOVSDFHRUEDVHPHQWDYDLODEOHWKDWFRXOGSUR YLGH DFFHVV IRU EXLOGLQJ ZLULQJ ZLWKRXW WKH UHPRYDORILQWHULRUILQLVKHV >)@ 6PRNH GHWHFWLRQ V\VWHP6PRNHGHWHFWRUV OLVWHGLQDFFRUGDQFHZLWK8/DQGSURYLGHGDVSDUWRI WKH EXLOGLQJ¶V ILUH DODUP V\VWHP VKDOO EH DQ DFFHSWDEOH DOWHUQDWLYHWRVLQJOHDQGPXOWLSOHVWDWLRQVPRNHDODUPV DQGVKDOOFRPSO\ZLWKWKHIROORZLQJ 7KHILUHDODUPV\VWHPVKDOOFRPSO\ZLWKDOODSSOLFD EOHUHTXLUHPHQWVLQ6HFWLRQRIWKH,QWHUQDWLRQDO )LUH&RGH $FWLYDWLRQ RI D VPRNH GHWHFWRU LQ D GZHOOLQJ RU VOHHSLQJXQLWVKDOOLQLWLDWHDODUPQRWLILFDWLRQLQWKH GZHOOLQJRUVOHHSLQJXQLWLQDFFRUGDQFHZLWK6HFWLRQ RIWKH,QWHUQDWLRQDO)LUH&RGH $FWLYDWLRQ RI D VPRNH GHWHFWRU LQ DGZHOOLQJRU VOHHSLQJ XQLW VKDOO QRW DFWLYDWH DODUP QRWLILFDWLRQ DSSOLDQFHVRXWVLGHRIWKHGZHOOLQJRUVOHHSLQJXQLW SURYLGHGWKDWDVXSHUYLVRU\VLJQDOLVJHQHUDWHGDQG PRQLWRUHGLQDFFRUGDQFHZLWK6HFWLRQRIWKH ,QWHUQDWLRQDO)LUH&RGH >)@6LQJOHDQGPXOWLSOHVWDWLRQVPRNHDODUPV6LQ JOHDQGPXOWLSOHVWDWLRQVPRNHDODUPVVKDOOEHWHVWHGDQG PDLQWDLQHG LQ DFFRUGDQFH ZLWK WKH PDQXIDFWXUHU¶V LQVWUXF WLRQV6PRNHDODUPVWKDWGRQRWIXQFWLRQVKDOOEHUHSODFHG 6PRNH DODUPV LQVWDOOHG LQ RQH DQG WZRIDPLO\ GZHOOLQJV VKDOOEHUHSODFHGQRWPRUHWKDQ\HDUVIURPWKHGDWHRI PDQXIDFWXUHPDUNHGRQWKHXQLWRUVKDOOEHUHSODFHGLIWKH GDWHRIPDQXIDFWXUHFDQQRWEHGHWHUPLQHG 6(&7,21 &$5%210212;,'($/$506$1''(7(&7,21 >)@ *HQHUDO &DUERQ PRQR[LGH DODUPV VKDOO EH LQVWDOOHGLQGZHOOLQJVLQDFFRUGDQFHZLWK6HFWLRQRI WKH,QWHUQDWLRQDO)LUH&RGHH[FHSWWKDWDODUPVLQGZHOOLQJV FRYHUHG E\ WKH,QWHUQDWLRQDO 5HVLGHQWLDO &RGH VKDOO EH LQVWDOOHGLQDFFRUGDQFHZLWK6HFWLRQ5RIWKDWFRGH >)@&DUERQPRQR[LGHDODUPVDQGGHWHFWRUV&DUERQ PRQR[LGH DODUPV DQG FDUERQ PRQR[LGH GHWHFWLRQ V\VWHPV VKDOOEHPDLQWDLQHGLQDFFRUGDQFHZLWK1)3$&DUERQ PRQR[LGH DODUPV DQG FDUERQ PRQR[LGH GHWHFWRUV WKDW EHFRPH LQRSHUDEOH RU EHJLQ SURGXFLQJ HQGRIOLIH VLJQDOV VKDOOEHUHSODFHG Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 5()(5(1&('67$1'$5'6 User note: About this chapter:This code contains numerous references to standards promulgated by other organizations that are used to provide requirements for materials and methods of construction. Chapter 8 contains a comprehensive list of all standards that are referenced in this code. These standards, in essence, are part of this code to the extent of the reference to the standard. This chapter lists the standards that are referenced in various sections of this document. The standards are listed herein by the promulgating agency of the standard, the standard identification, the effective date and title and the section or sections of this document that reference the standard. The application of the referenced standards shall be as specified in Section 102.7. $60($PHULFDQ6RFLHW\RI0HFKDQLFDO(QJLQHHUV 7ZR3DUN$YHQXH 1HZ<RUN1< $60($²&6$%²6DIHW\&RGHIRU(OHYDWRUVDQG(VFDODWRUV $670 $670,QWHUQDWLRQDO %DUU+DUERU'ULYH32%R[& :HVW&RQVKRKRFNHQ3$ )²3HUIRUPDQFH6SHFLILFDWLRQVIRU6DIHW\&RYHUVDQG/DEHOLQJ5HTXLUHPHQWVIRU$OO&RYHUVIRU6ZLPPLQJ3RROV6SDV DQG+RW7XEV ,&&,QWHUQDWLRQDO&RGH&RXQFLO 1HZ-HUVH\$YHQXH1: WK)ORRU :DVKLQJWRQ'& ,%&²,QWHUQDWLRQDO%XLOGLQJ&RGH ,(&&²,QWHUQDWLRQDO(QHUJ\&RQVHUYDWLRQ&RGH ,(%&²,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ&RGH ,)&²,QWHUQDWLRQDO)LUH&RGH ,)*&²,QWHUQDWLRQDO)XHO*DV&RGH ,0&²,QWHUQDWLRQDO0HFKDQLFDO&RGH ,3&²,QWHUQDWLRQDO3OXPELQJ&RGH ,5&²,QWHUQDWLRQDO5HVLGHQWLDO&RGH ,=&²,QWHUQDWLRQDO=RQLQJ&RGH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 5()(5(1&('67$1'$5'6 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 1)3$1DWLRQDO)LUH3URWHFWLRQ$VVRFLDWLRQ %DWWHU\PDUFK3DUN 4XLQF\0$ ²6WDQGDUGIRU3RUWDEOH)LUH([WLQJXLVKHUV 7DEOH ²6WDQGDUGRQ&DUERQ'LR[LGH([WLQJXLVKLQJ6\VWHPV 7DEOH $²6WDQGDUGRQ+DORQ)LUH([WLQJXLVKLQJ6\VWHPV 7DEOH ²6WDQGDUGIRU'U\&KHPLFDO([WLQJXLVKLQJ6\VWHPV 7DEOH $²6WDQGDUGIRU:HW&KHPLFDO([WLQJXLVKLQJ6\VWHPV 7DEOH ²6WDQGDUGIRUWKH,QVSHFWLRQ7HVWLQJDQG0DLQWHQDQFHRI:DWHU%DVHG)LUH3URWHFWLRQ6\VWHPV 7DEOH ²1DWLRQDO(OHFWULFDO&RGH ²1DWLRQDO)LUH$ODUPDQG6LJQDOLQJ&RGH 7DEOH ²6WDQGDUGIRU)LUH'RRUVDQG2WKHU2SHQLQJ3URWHFWLYHV ²6WDQGDUGIRU6PRNH'RRU$VVHPEOLHVDQG2WKHU2SHQLQJ3URWHFWLYHV ²6WDQGDUGIRU6PRNHDQG+HDW9HQWLQJ 7DEOH ²6WDQGDUGIRUWKH,QVWDOODWLRQRI&DUERQ0RQR[LGH&2'HWHFWLRQDQG:DUQLQJ(TXLSPHQW >)@ ²6WDQGDUGRQ:DWHU0LVW)LUH3URWHFWLRQ6\VWHPV 7DEOH ²6WDQGDUGRQ&OHDQ$JHQW)LUH([WLQJXLVKLQJ6\VWHPV 7DEOH 8/8QGHUZULWHUV/DERUDWRULHV//& 3ILQJVWHQ5RDG 1RUWKEURRN,/ ²6PRNH'HWHFWRUVIRU)LUH$ODUP6\VWHPV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( $33(1',;$ %2$5',1*67$1'$5' 7KHSURYLVLRQVFRQWDLQHGLQWKLVDSSHQGL[DUHQRWPDQGDWRU\XQOHVVVSHFLILFDOO\UHIHUHQFHGLQWKHDGRSWLQJRUGLQDQFH User note: About this appendix: Appendix A provides minimum specifications for boarding a structure. This can be utilized by a jurisdiction as a set of minimum requirements in order to result in consistent boarding quality. These requirements also provide a reasonable means to eliminate having to approve numerous methods or materials for the boarding and securing of a structure. It is important to note that the provisions of Appendix A are not mandatory unless specifically referenced in the adopting ordinance of the authority having jurisdiction. $ *(1(5$/ $*HQHUDO:LQGRZVDQGGRRUVVKDOOEHERDUGHGLQDQ DSSURYHGPDQQHUWRSUHYHQWHQWU\E\XQDXWKRUL]HGSHUVRQV DQGVKDOOEHSDLQWHGWRFRUUHVSRQGWRWKHFRORURIWKHH[LVWLQJ VWUXFWXUH $ 0$7(5,$/6 $%RDUGLQJVKHHWPDWHULDO%RDUGLQJVKHHWPDWHULDO VKDOOEHPLQLPXPLQFKWKLFNPPZRRGVWUXFWXUDO SDQHOVFRPSO\LQJZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH $ %RDUGLQJ IUDPLQJ PDWHULDO %RDUGLQJ IUDPLQJ PDWHULDOVKDOOEHPLQLPXPQRPLQDOLQFKE\LQFKPP E\PPVROLGVDZQOXPEHUFRPSO\LQJZLWKWKH,QWHUQD WLRQDO%XLOGLQJ&RGH $ %RDUGLQJ IDVWHQHUV %RDUGLQJ IDVWHQHUV VKDOO EH PLQLPXPLQFKGLDPHWHUPPFDUULDJHEROWVRIVXFKD OHQJWKDVUHTXLUHGWRSHQHWUDWHWKHDVVHPEO\DQGDVUHTXLUHG WRDGHTXDWHO\DWWDFKWKHZDVKHUVDQGQXWV:DVKHUVDQGQXWV VKDOOFRPSO\ZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH $ ,167$//$7,21 $ %RDUGLQJ LQVWDOODWLRQ 7KH ERDUGLQJ LQVWDOODWLRQ VKDOOEHLQDFFRUGDQFHZLWK)LJXUHV$DQG$ DQG6HFWLRQV$WKURXJK$ $%RDUGLQJVKHHWPDWHULDO7KHERDUGLQJVKHHWPDWH ULDOVKDOOEHFXWWRILWWKHGRRURUZLQGRZRSHQLQJQHDWO\RU VKDOOEHFXWWRSURYLGHDQHTXDORYHUODSDWWKHSHULPHWHURIWKH GRRURUZLQGRZ $:LQGRZV7KHZLQGRZVKDOOEHRSHQHGWRDOORZWKH FDUULDJHEROWWRSDVVWKURXJKRUWKHZLQGRZVDVKVKDOOEH UHPRYHGDQGVWRUHG7KHLQFKE\LQFKPPE\ PPVWURQJEDFNIUDPLQJPDWHULDOVKDOOEHFXWPLQLPXP LQFKHVPPZLGHUWKDQWKHZLQGRZRSHQLQJDQGVKDOOEH SODFHGRQWKHLQVLGHRIWKHZLQGRZRSHQLQJLQFKHV PPPLQLPXPDERYHWKHERWWRPDQGEHORZWKHWRSRIWKH ZLQGRZ RSHQLQJ 7KH IUDPLQJ DQG ERDUGLQJ VKDOO EH SUH GULOOHG7KHDVVHPEO\VKDOOEHDOLJQHGDQGWKHEROWVZDVKHUV DQGQXWVVKDOOEHLQVWDOOHGDQGVHFXUHG $'RRUZDOOV7KHGRRURSHQLQJVKDOOEHIUDPHGZLWK PLQLPXP LQFK E\ LQFK PP E\ PP IUDPLQJ PDWHULDOVHFXUHGDWWKHHQWLUHSHULPHWHUDQGYHUWLFDOPHPEHUV DWDPD[LPXPRILQFKHVPPRQFHQWHU%ORFNLQJ VKDOODOVREHVHFXUHGDWDPD[LPXPRILQFKHVPP RQFHQWHUYHUWLFDOO\%RDUGLQJVKHHWPDWHULDOVKDOOEHVHFXUHG ZLWKVFUHZVDQGQDLOVDOWHUQDWLQJHYHU\LQFKHVPPRQ FHQWHU $'RRUV'RRUVVKDOOEHVHFXUHGE\WKHVDPHPHWKRGDV IRUZLQGRZVRUGRRURSHQLQJV2QHGRRUWRWKHVWUXFWXUHVKDOO EHDYDLODEOHIRUDXWKRUL]HGHQWU\DQGVKDOOEHVHFXUHGDQG ORFNHGLQDQDSSURYHGPDQQHU $ 5()(5(1&('67$1'$5' ,%&² ,QWHUQDWLRQDO%XLOGLQJ&RGH $ $$ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,QWHUQDWLRQDO %XLOGLQJ &RGH ,QWHUQD ,QWHUQDWLRQDO %XLOGLQJ &RGH 1 23 4 Page: 48 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:28:03 AM -05'00' MSBC Number: 2 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:28:12 AM -05'00' MSBC Number: 3 Author: MPoehlman Date: 12/23/2019 2:40:32 PM Number: 4 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:29:49 AM -05'00' MSBC $33(1',;$ ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 3/8″ carriage bolts. Bolts shall be long enough to extend from the exterior plywood through the interior plywood and strong backs and fastened from the interior with a nut. 2″ x 4″ strong backs Window frame 2″ x 4″ strong backs ½″ CDX plywood or performance-rated OSB. 3/8″ carriage bolts. Bolts shall be long enough to extend from the exterior plywood through the interior plywood and strong backs and fastened from the interior with a nut. 12″ 6″ ),*85($ %2$5',1*2)'22525:,1'2: ½ INCH CDX PLYWOOD OR PERFORMANCE-RATED OSB SHALL BE SECURED TO HEADER, BSE PLATE, STUDS, STILES, AND EDGE BLOCKING USING ALTERNATE SCREWS AND NAILS AT A MAXIMUM OF 6 INCHES O.C. 2 INCH x 4 INCH HEADER 2 INCH x 4 INCH STILE 2 INCH x 4 INCH BASE PLATE 2 INCH x 4 INCH STUDS SPACED 24 INCHES ON CENTER 2 INCH x 4 INCH EDGE BLOCKING EITHER HORIZONTALLY OR VERTICALLY ALONG EDGE OF EACH SHEET OF PLYWOOD OR OSB. For SI: 1 inch = 25.4 mm. DOOR WALL FRAME ),*85($ %2$5',1*2)'225:$// Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( ,1'(; $ $&&(66 Emergency egress . . . . . . . . . . . . . . . . . . . . . . . . 702 From bedrooms . . . . . . . . . . . . . . . . . . . . . . . 404.4.2 Plumbing fixtures, access for cleaning . . . . . . . .504.2 To public way . . . . . . . . . . . . . . . . . . . . . . . . . . .702.1 Toilet room as passageway . . . . . . . . . . . . . . . .503.1 Water closet . . . . . . . . . . . . . . . . . . . . . . . . . . 404.4.3 $'-$&(17 Privacy (hotel units, rooming units). . . . . . . . . . .404.1 $'0,1,675$7,21 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101.2 $*(176HHDOVR23(5$7252:1(5 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 $,5 Combustion air . . . . . . . . . . . . . . . . . . . . . . . . . .603.5 $,6/(6 Minimum width . . . . . . . . . . . . . . . . . . . . . . . . . .702.2 $/7(5$7,21 Applicability of other codes. . . . . . . . . . . . . . . . .102.3 Inspection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .104.2 Prosecution. . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.3 Unlawful acts . . . . . . . . . . . . . . . . . . . . . . . . . . .106.1 $1&+25 Anchored, definition . . . . . . . . . . . . . . . . . . . . . . . 202 Architectural trim. . . . . . . . . . . . . . . . . . . . . . . . .304.8 Signs, marquees and awnings . . . . . . . . . . . . . .304.9 Unsafe conditions. . . . . . . . . . . . . . . . . . . . . . 304.1.1 $33($/ Application . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.1 Board decision . . . . . . . . . . . . . . . . . . . . . . . . . .111.6 Board of appeals . . . . . . . . . . . . . . . . . . . . . . . .111.2 Court review . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.7 Disqualification . . . . . . . . . . . . . . . . . . . . . . . . 111.2.3 Financial interest . . . . . . . . . . . . . . . . . . . . . . 111.2.3 Hearing, emergency orders . . . . . . . . . . . . . . . .109.6 Membership . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.2 Notice of appeal . . . . . . . . . . . . . . . . . . . . . . . . .111.1 Postponed hearing . . . . . . . . . . . . . . . . . . . . . . .111.5 Records . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .104.6 Right to appeal . . . . . . . . . . . . . . . . . . . . . . . . . .111.1 Vote . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.6 $33/,$1&( Cooking . . . . . . . . . . . . . . . . . . . . . . . . . 403.3, 602.2 Mechanical . . . . . . . . . . . . . . . . . . . . . . . . . . . . .603.1 $33/,&$%,/,7< Application of references . . . . . . . . . . . . . . . . . .102.9 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102.1 Other laws. . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.10 Referenced codes and standards. . . . . . . . . . . 102.7 $33529$/ Alternatives. . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.2 Authority . . . . . . . . . . . . . . . . . . . . . . . . . 104.1, 105.2 Modifications. . . . . . . . . . . . . . . . . . . . . . . . . . . 105.1 Research reports . . . . . . . . . . . . . . . . . . . . . . . 105.6 Used material and equipment. . . . . . . . . . . . . . 105.4 $33529(' Alternative materials, methods and equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.2 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Energy conservation devices . . . . . . . . . . . . . . 603.6 Garbage storage facilities. . . . . . . . . . . . . . . . 308.3.1 Modifications. . . . . . . . . . . . . . . . . . . . . . . . . . . 105.1 Used materials and equipment. . . . . . . . . . . . . 105.4 $57,),&,$/ Lighting of habitable rooms. . . . . . . . . . . . . . . . 401.3 Lighting of other spaces . . . . . . . . . . . . . . . . . . 402.3 $87202%,/( Motor vehicles. . . . . . . . . . . . . . . . . . . . . . . . . . 302.8 $:1,1* Signs, marquees and awnings . . . . . . . . . . . . . 304.9 % %$/&21< Handrails and guardrails. . . . . . . . . . . . . . . . . 304.12 %$6(0(17 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Hatchways . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.16 Windows . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.17 %$7+5220 Common bathrooms . . . . . . . . . . . . . . . . 502.3, 503.1 Hotels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502.3 Lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Locks. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503.1 Outlets required . . . . . . . . . . . . . . . . . . . . . . . . 605.2 Privacy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503.1 Ventilation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403.2 %$7+78% Dwelling units . . . . . . . . . . . . . . . . . . . . . . . . . . 502.1 Rooming houses. . . . . . . . . . . . . . . . . . . . . . . . 502.2 Sewage system. . . . . . . . . . . . . . . . . . . . . . . . . 506.1 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . 505.1 %2$5',1* Boarding standard. . . . . . . . . . . . . . . . . . .Appendix A Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( %2,/(5 Unsafe equipment . . . . . . . . . . . . . . . . . . . . . 108.1.2 & &$3$&,7< Heating facilities. . . . . . . . . . . . . . 602.2, 602.3, 602.4 &$56HH$87202%,/( &$5%210212;,'($/$506$1''(7(&7,21 Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 705.1 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . 705.2 &(,/,1* Basement rooms . . . . . . . . . . . . . . . . . . . . . . . . 404.3 Fire-resistance ratings. . . . . . . . . . . . . . . . . . . . 703.1 Interior surfaces. . . . . . . . . . . . . . . . . . . . . . . . . 305.3 Minimum height . . . . . . . . . . . . . . . . . . . . . . . . . 404.3 Sleeping rooms . . . . . . . . . . . . . . . . . . . . . . . . . 404.3 &+$1*(02',)< Application of other codes . . . . . . . . . . . . . . . . . 102.3 &+,01(< Exterior structure . . . . . . . . . . . . . . . . . . . . . . . 304.11 Flue . . . . . . . . . . . . . . . . . . . . . . . . . . . . 603.2, 603.3 &/($1,1* Access for cleaning . . . . . . . . . . . . . . . . . . . . . . 504.2 Disposal of garbage. . . . . . . . . . . . . . . . . . . . . . 308.3 Disposal of rubbish . . . . . . . . . . . . . . . . . . . . . . 308.2 Interior and exterior sanitation . . . . . . . . . . . . . . 308.1 Interior surfaces. . . . . . . . . . . . . . . . . . . . . . . . . 305.3 Plumbing facilities, maintained . . . . . . . . . . . . . 504.1 Required plumbing facilities. . . . . . . . . . . . . . . . . 502 Responsibility of persons. . . . . . . . . . . . . . . . . . 305.1 Trash containers . . . . . . . . . . . . . . . . . . . . . . 308.3.2 Vacant structures and land . . . . . . . . . . . . . . . . 301.3 &/($5$1&( Heating facilities. . . . . . . . . . . . . . . . . . . . . . . . . 603.3 Plumbing fixtures . . . . . . . . . . . . . . . . . . . . . . . . 504.2 &/26,1* Streets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109.3 Vacant structures. . . . . . . . . . . . . . . . . . . . . . . . 108.2 &/27+(6'5<(5 Exhaust . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403.5 &2'(2)),&,$/ Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1 Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Duties. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 Emergency order . . . . . . . . . . . . . . . . . . . . . . . . . 109 Enforcement authority . . . . . . . . . . . . . . . . . . . . 104.1 Failure to comply with demolition order . . . . . . . 110.3 Identification. . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.3 Inspections. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.2 Liability, relief of personal. . . . . . . . . . . . . . . . . .103.4 Membership of board of appeals . . . . . . . . . . . .111.2 Notice of violation. . . . . . . . . . . . . . . . . . . .104.5, 107 Notices and orders. . . . . . . . . . . . . . . . . . . . . . . . 107 Official records. . . . . . . . . . . . . . . . . . . . . . . . . .104.6 Personal liability. . . . . . . . . . . . . . . . . . . . . . . . .103.4 Placarding . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108.4 Prosecution . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.3 Removal of placard . . . . . . . . . . . . . . . . . . . . 108.4.1 Right of entry . . . . . . . . . . . . . . . . . . . . . . . . . . .104.3 Transfer of ownership . . . . . . . . . . . . . . . . . . . .107.6 Vacant structures. . . . . . . . . . . . . . . . . . . . . . . .108.2 Voting of appeals board. . . . . . . . . . . . . 111.2, 111.6 &20%867,21 Combustion air. . . . . . . . . . . . . . . . . . . . . . . . . .603.5 &20321(176(59,&($%,/,7< Unsafe conditions. . . . . . . . . . . . . . . . . . . . . . 306.1.1 &21'(01$7,21 Closing of vacant structures. . . . . . . . . . . . . . . .108.2 Failure to comply . . . . . . . . . . . . . . . . . . . . . . . .110.3 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108.1 Notices and orders. . . . . . . . . . . . . . . . . 108.2, 108.3 Placarding . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108.4 Removal of placard . . . . . . . . . . . . . . . . . . . . 108.4.1 &21)/,&7 Conflict of interest . . . . . . . . . . . . . . . . . . . . . 111.2.3 Violations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.1 &211(&7,21 Sewage system . . . . . . . . . . . . . . . . . . . . . . . . .506.1 Water heating. . . . . . . . . . . . . . . . . . . . . . . . . . .505.4 Water system. . . . . . . . . . . . . . . . . . . . . . . . . . .505.1 &216758&7,21 Existing structures . . . . . . . . . . . . . . . . . . . . . . .101.2 &217$,1(5 Garbage. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 308.3.2 Rubbish storage. . . . . . . . . . . . . . . . . . . . . . . 308.2.1 &217,18286 Unobstructed egress . . . . . . . . . . . . . . . . . . . . .702.1 &21752/ Rodent control . . . . . . . . . . . . . . . . . . . . 302.5, 304.5 Safety controls . . . . . . . . . . . . . . . . . . . . . . . . . .603.4 Weed . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.4 &22/,1* Cooling towers . . . . . . . . . . . . . . . . . . . . . . . . .304.11 &255,'25 Accumulation of rubbish. . . . . . . . . . . . . . . . . . .308.1 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .402.2 Lighting fixtures . . . . . . . . . . . . . . . . . . . . . . . . .605.3 Obstructions. . . . . . . . . . . . . . . . . . . . . . 702.1, 702.2 Ratings maintained . . . . . . . . . . . . . . . . . . . . . . . 703 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( ' '$03'$031(66 Roofs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.7 Window, door frames . . . . . . . . . . . . . . . . . . . .304.13 '$1*(5286+$=$5'286 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . .108.1 Demolition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Electrical hazards . . . . . . . . . . . . . . . . .604.3, 604.3.1 Existing remedies . . . . . . . . . . . . . . . . . . . . . . . .102.4 Imminent danger. . . . . . . . . . . . . . . . . . . . . . . . . . 202 Unsafe equipment . . . . . . . . . . . . . . . . . . . . . 108.1.2 Unsafe structures or premises . . . . . . . . . . . . 108.1.5 '(&.6 Handrails and guardrails. . . . . . . . . . . . . . . . . .304.12 Maintenance. . . . . . . . . . . . . . . . . . . . . 304.2, 304.10 '(02/,7,21 Existing remedies . . . . . . . . . . . . . . . . . . . . . . . .102.4 Failure to comply . . . . . . . . . . . . . . . . . . . . . . . .110.3 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Order . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .110.2 Salvage materials. . . . . . . . . . . . . . . . . . . . . . . .110.4 '(7(&7256 Smoke . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 704 '(7(5,25$7,21 Components of systems. . . . . . . . . . . . . . . . . 306.1.1 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Exterior structure . . . . . . . . . . . . . . . . . . . . . . 304.1.1 Exterior walls . . . . . . . . . . . . . . . . . . . . . . . . . . .304.6 ',5(&7 Egress . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .702.1 ',6326$/ Disposal of garbage . . . . . . . . . . . . . . . . . . . . . .308.3 Disposal of rubbish. . . . . . . . . . . . . . . . . . . . . . .308.2 '225 Exit doors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .702.3 Fire . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.2 Hardware . . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.15 Insect screens . . . . . . . . . . . . . . . . . . . . . . . . .304.14 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Locks . . . . . . . . . . . . . . . . . . . . . . . . . . 304.15, 702.3 Maintenance. . . . . . . . . . . . . . . . . . . . 304.13, 304.15 Weather tight . . . . . . . . . . . . . . . . . . . . . . . . . .304.13 Window and door frames . . . . . . . . . . . . . . . . .304.13 '250,725<5220,1*+286(+27(/027(/ Locked doors . . . . . . . . . . . . . . . . . . . . . . . . . . .702.3 Privacy . . . . . . . . . . . . . . . . . . . . . . . . . . 503.1, 503.2 '5$)767233,1* Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.1 '5$,1'5$,1$*( Basement hatchways . . . . . . . . . . . . . . . . . . . .304.16 Plumbing connections. . . . . . . . . . . . . . . . . . . . . . 506 Storm drainage . . . . . . . . . . . . . . . . . . . . . . . . . . . 507 '8&7 Exhaust duct. . . . . . . . . . . . . . . . . . . . . . . . . . . 304.9 Duct systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 607 '867 Process ventilation . . . . . . . . . . . . . . . . . . . . . . 403.4 ':(//,1* Cleanliness . . . . . . . . . . . . . . . . . . . . . . . 305.1, 308.1 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Electrical . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 604.1 Heating facilities . . . . . . . . . . . . . . . . . . . . . . . . . . 602 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . . 502 ( (*5(66 Aisles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 702.2 Emergency escape. . . . . . . . . . . . . . . . . . . . . . 702.4 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 702.1 Lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402.2 Locked doors . . . . . . . . . . . . . . . . . . . . . . . . . . 702.3 Obstructions prohibited. . . . . . . . . . . . . . . . . . . 702.1 Stairs, porches and railings. . . . . . . . . . . . . . . 304.10, 305.4, 305.5, 307.1 (/(&75,&(/(&75,&$/(48,30(17 Abatement of hazards, fire exposure . . . . . . . 604.3.2 Abatement of hazards, water exposure . . . . . 604.3.1 Condemnation. . . . . . . . . . . . . . . . . . . . . . . . . . 108.1 Electrical equipment . . . . . . . . . . . . . . . . . . 604.3.1.1 Facilities required . . . . . . . . . . . . . . . . . . . . . . . 604.1 Hazards. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 604.3 Installation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.1 Lighting fixtures. . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Receptacles . . . . . . . . . . . . . . . . . . . . . . 604.3, 605.2 Responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . 601.2 Service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 604.2 (/(9$725(6&$/$7256'80%:$,7(56 Condemnation. . . . . . . . . . . . . . . . . . . . . . . . . . 108.1 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 606.1 Maintenance . . . . . . . . . . . . . . . . . . . . . . 606.1, 606.2 (0(5*(1&< Emergency escape openings . . . . . . . . . . . . . . 702.4 Emergency measures. . . . . . . . . . . . . . . . . . . . . . 109 Emergency orders. . . . . . . . . . . . . . . . . . . . . . . 109.1 (1)25&(0(17 Duties and powers . . . . . . . . . . . . . . . . . . . . . . . . 104 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 (48,30(17 Alternative. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.2 Combustion air . . . . . . . . . . . . . . . . . . . . . . . . . 603.5 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Condemnation . . . . . . . . . . . . . . . . . . . 108.1.2, 108.3 Electrical installation . . . . . . . . . . . . . . . . . . . . . 605.1 Emergency order . . . . . . . . . . . . . . . . . . . . . . . . 109.1 Energy conservation devices. . . . . . . . . . . . . . . 603.6 Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 603.1 Interior structure. . . . . . . . . . . . . . . . . . . . . . . . . 305.1 Placarding . . . . . . . . . . . . . . . . . . . . . . . 108.4, 108.5 Prohibited use . . . . . . . . . . . . . . . . . . . . . . . . . . 108.5 Responsibility. . . . . . . . . . . . . . . . . . . . . . . . . . . 601.2 Safety controls. . . . . . . . . . . . . . . . . . . . . . . . . . 603.4 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 Scope, mechanical and electrical . . . . . . . . . . . 601.1 Support, definition . . . . . . . . . . . . . . . . . . . . . . . . 202 Unsafe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1.2 Used . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.4 (;+$867 Clothes dryer . . . . . . . . . . . . . . . . . . . . . . . . . . . 403.5 Exhaust ducts . . . . . . . . . . . . . . . . . . . . . . . . . . 304.9 Process ventilation. . . . . . . . . . . . . . . . . . . . . . . 403.4 (;,67,1* Remedies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.4 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 Structural members . . . . . . . . . . . . . . . 304.1.1, 304.4 Structures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.3 (;7(5,25 Decorative features . . . . . . . . . . . . . . . . . . . . . . 304.8 Exterior structure . . . . . . . . . . . . . . . . . . . . . . . . . 304 Exterior walls . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.6 Painting . . . . . . . . . . . . . . . . . . . . . . . . . 304.2, 304.6 Rodent harborage . . . . . . . . . . . . . . . . . 302.5, 304.5 Sanitation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.1 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.1 Stair . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.10 Street numbers . . . . . . . . . . . . . . . . . . . . . . . . . 304.3 Unsafe conditions . . . . . . . . . . . . . . . . . . . . . 304.1.1 Weather tight . . . . . . . . . . . . . . . . . . . . . . . . . . 304.13 ) )$1 Exhaust vents . . . . . . . . . . . . . . . . . . . . . . . . . . 302.6 )((6(;3(16(6&267 Closing vacant structures . . . . . . . . . . . . . . . . . 108.2 Demolition . . . . . . . . . . . . . . . . . . 110.1, 110.3, 110.4 Extermination. . . . . . . . . . 309.2, 309.3, 309.4, 309.5 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103.5 Relief from personal liability. . . . . . . . . . . . . . . . 103.4 )(1&( Accessory . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 302.7 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.2 ),5( Blocking Maintenance . . . . . . . . . . . . . . . . . . 703.3.1 ),5('(3$570(17 Connection access. . . . . . . . . . . . . . 704.5.1, 704.5.2 Connections. . . . . . . . . . . . . . . . . . . . . . . . . . . .704.5 ),5(3527(&7,216<67(06 Emergency impairments . . . . . . . . . . . . . . . . 704.3.1 Equipment . . . . . . . . . . . . . . .704.4, 704.4.1, 704.4.2 Inspection. . . . . . . . . . . . . . . . . 704.1, 704.1.3, 704.2 Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . 704.1.1 Maintenance. . . . . . . . . . . . . . . 704.1, 704.1.3, 704.2 Out of service. . . . . . . . . . . . . . . . . . . . . . . . . . .704.3 Records of maintenance . . . . . . . . . . . . . . . . 704.2.1 Required systems . . . . . . . . . . . . . . 704.1.2, 704.2.2 Smoke alarms . . . . . . . . . . . . . . . . . . . . . . . . . .704.6 Smoke detections systems . . . . . . . . . . . . . . 704.6.4 Termination of service . . . . . . . . . . . . . . . . . . 704.4.3 Testing . . . . . . . . . . . . . . . . . . . 704.1, 704.1.3, 704.2 ),5(5(6,67$1&(5$7,1*6 Ceilings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.5 Draft stopping . . . . . . . . . . . . . . . . . . . . . . . . 703.3.1 Fire barriers . . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.3 Fire blocking . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.1 Fire partitions . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.3 Fire walls . . . . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.3 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . .703.3 Opening protective. . . . . . . . . . . . . . . . . . . . . . .703.4 Shafts. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.7 Smoke barriers. . . . . . . . . . . . . . . . . . . . . . . . 703.3.2 Smoke partitions . . . . . . . . . . . . . . . . . . . . . . 703.3.2 Unsafe conditions. . . . . . . . . . . . . . . . . . . . . . . .703.2 )/$00$%/(/,48,' Containers . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1.2 )/225)/225,1* Area for sleeping purposes . . . . . . . . . . . . . . 404.4.1 Fire-resistance ratings . . . . . . . . . . . . . . . . . . . .703.1 Interior surfaces . . . . . . . . . . . . . . . . . . . 305.1, 305.3 Space requirements. . . . . . . . . . . . . . .404.4.1, 404.6 )22'35(3$5$7,21 Cooking equipment . . . . . . . . . . . . . . . . . . . . . .403.3 Sanitary condition. . . . . . . . . . . . . . . . . . 305.1, 404.7 Ventilation . . . . . . . . . . . . . . . . . . . . . . . . . . . . .403.4 )281'$7,21 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . 108.1.1 Foundation walls . . . . . . . . . . . . . . . . . . . . . . . .304.5 Unsafe conditions. . . . . . . . . . . . . . . 304.1.1, 305.1.1 )5$0( Window and door frames. . . . . . . . . . . . . . . . .304.13 * *$6 Energy conservation devices. . . . . . . . . . . . . . .603.6 Exhaust vents. . . . . . . . . . . . . . . . . . . . . . . . . . .302.6 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( */$=,1* Materials. . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.13.1 *5$'( Drainage. . . . . . . . . . . . . . . . . . . . . . . . . . .302.2, 507 *8$5' Anchorage and maintenance . . . . . . . . . . . . . .304.12 Basement windows. . . . . . . . . . . . . . . . . . . . 304.18.2 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 + +$%,7$%/( Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 Minimum ceiling height. . . . . . . . . . . . . . . . . . . .404.3 Minimum room width . . . . . . . . . . . . . . . . . . . . .404.2 Required plumbing facilities . . . . . . . . . . . . . . . . . 502 Residential heating facilities . . . . . . . . . . 602.2, 602.3 Space requirements . . . . . . . . . . . . . . . . . . . . 404.4.1 Ventilation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403 +$1'5$,/6$1'*8$5'5$,/6 Handrails . . . . . . . . . . . . . . . . . .304.12, 305.5, 307.1 Stairs and porches . . . . . . . . . . . . . . . . . . . . . .304.10 +$5':$5( Door hardware . . . . . . . . . . . . . . . . . . . 304.15, 702.3 Openable windows . . . . . . . . . . . . . . . . . . . . 304.13.2 +$=$5'2866HH'$1*(5286+$=$5'286 +($7+($7,1* Energy conservation devices . . . . . . . . . . . . . . .603.6 Fireplaces. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .603.1 Heating . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .603.1 Mechanical equipment . . . . . . . . . . . . . . . . . . . .603.1 Required capabilities . . . . . . . . . . . . . . . . . . . . . . 602 Residential heating. . . . . . . . . . . . . . . . . 602.2, 602.3 Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .602.3 Water heating facilities . . . . . . . . . . . . . . . . . . . .505.4 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 +(,*+7 Minimum ceiling height. . . . . . . . . . . . . . . . . . . .404.3 +276HH+($7+($7,1* +27(/65220,1*+286(6$1''250,725< 81,76027(/6 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Locked doors . . . . . . . . . . . . . . . . . . . . . . . . . . .702.3 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . . 502 Toilet rooms . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503 +286(.((3,1*81,7 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 , ,'(17,),&$7,21 Code official . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.4 ,1)(67$7,21 Condemnation. . . . . . . . . . . . . . . . . . . . . . . . . 108.1.3 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Insect and rodent . . . . . . . . . . . 302.5, 304.14, 309.1 ,16(&76 Infestation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 309.1 Insect screens. . . . . . . . . . . . . . . . . . . . . . . . . 304.14 Pest elimination. . . . . . . . . . . . . . . . . . . . . . . . . . . 309 ,163(&7,216 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.2 Right of entry. . . . . . . . . . . . . . . . . . . . . . . . . . . 104.3 ,163(&725 Identification . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.4 Inspections . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.2 Records. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.6 ,17(17 Code . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.3 ,17(5,25 Interior structure . . . . . . . . . . . . . . . . . . . . . . . . . . 305 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . 305.3 Means of egress . . . . . . . . . . . . . . . . . . . . . . . . . . 702 Sanitation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 305.1 Unsafe conditions . . . . . . . . . . . . . . . . . . . . . . 305.1.1 - -85,6',&7,21 Title. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.1 . .,7&+(1 Electrical outlets required . . . . . . . . . . . . . . . . . 605.2 Minimum width . . . . . . . . . . . . . . . . . . . . . . . . . 404.2 Prohibited use. . . . . . . . . . . . . . . . . . . . . . . . . 404.4.4 Room lighting . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Water heating facilities . . . . . . . . . . . . . . . . . . . 505.4 / /$1',1* Handrails and guards . . . . . . . . . . . . . . . . . . . 304.12, 305.5, 306.1 Maintenance . . . . . . . . . . . . . . . . . . . . . 304.10, 305.4 /$81'5< Room lighting . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( /$9$725< Hotels. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502.3 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . 502 Rooming houses . . . . . . . . . . . . . . . . . . . . . . . . 502.2 Sanitary drainage system . . . . . . . . . . . . . . . . . . 506 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 Water system. . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 /($6(6(//5(17 Heat supplied. . . . . . . . . . . . . . . . . . . . . . . . . . . 602.3 Salvage materials . . . . . . . . . . . . . . . . . . . . . . . 110.4 Transfer of ownership . . . . . . . . . . . . . . . . . . . . 107.6 /,(1 Closing of vacant structures . . . . . . . . . . . . . . . 108.2 Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110.3 Failure to comply . . . . . . . . . . . . . . . . . . . . . . . . 110.3 /,*+7/,*+7,1* Common halls and stairways. . . . . . . . . 402.2, 605.3 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 Habitable rooms. . . . . . . . . . . . . . . . . . . . . . . . . 402.1 Kitchen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Laundry rooms. . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Luminaires. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Other spaces . . . . . . . . . . . . . . . . . . . . . . . . . . . 402.3 Responsibility. . . . . . . . . . . . . . . . . . . . . . . . . . . 401.2 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 Toilet rooms. . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 /,9,1*5220 Room area. . . . . . . . . . . . . . . . . . . . . . . . . . . 404.4.1 /2$'/2$',1* Elevators, escalators and dumbwaiters. . . . . . . 606.1 Handrails and guardrails . . . . . . . . . . . 304.12, 305.5 Live load . . . . . . . . . . . . . . . . . . . . . . . . 304.4, 305.2 Stairs and porches. . . . . . . . . . . . . . . . 304.10, 305.2 Structural members . . . . . . . . . . . . . . . . 304.4, 305.2 0 0$,17(1$1&( Required . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.2 0$7(5,$/ Alternative . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.2 Salvage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110.4 Used . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.4 0($162)(*5(666HH(*5(66 0(&+$1,&$/ Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 603.1 Responsibility. . . . . . . . . . . . . . . . . . . . . . . . . . . 601.2 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 601.1 Ventilation, general . . . . . . . . . . . . . . . . . . . . . . . 403 Ventilation, toilet rooms . . . . . . . . . . . . . . . . . . . 403.2 0,1,080 Ceiling height. . . . . . . . . . . . . . . . . . . . . . . . . . . 404.3 Room area . . . . . . . . . . . . . . . . . . . . . . . . . . . 404.4.1 Room width . . . . . . . . . . . . . . . . . . . . . . . . . . . .404.2 02',),&$7,21 Approval. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .105.1 027(/6HH+27(/6 027259(+,&/(6 Inoperative . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.8 Painting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.8 1 1$785$/ Lighting. . . . . . . . . . . . . . . . . . . . . . . . . . . .401.3, 402 Ventilation . . . . . . . . . . . . . . . . . . . . . . . . .401.3, 403 127,&(6$1'25'(56 Appeal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.1 Form. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107.2 Method of service. . . . . . . . . . . . . . . . . . . . . . . .107.3 Orders . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 Owner, responsible person . . . . . . . . . . . . . . . .107.1 Penalties . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107.5 Placarding of structure. . . . . . . . . . . . . . . . . . . .108.4 Transfer of ownership . . . . . . . . . . . . . . . . . . . .107.6 Unauthorized tampering. . . . . . . . . . . . . . . . . . .107.4 Vacating structure . . . . . . . . . . . . . . . . . . . . . . .108.2 12;,286 Process ventilation. . . . . . . . . . . . . . . . . . . . . . .403.4 Weeds . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.4 18,6$1&( Closing of vacant structures. . . . . . . . . . . . . . . .108.2 2 2%6758&7,21 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .402.1 Right of entry . . . . . . . . . . . . . . . . . . . . . . . . . . .104.3 2&&83$1&<6HH86( 23(1$%/( Locked doors . . . . . . . . . . . . . . . . . . . . . . . . . . .702.3 Windows. . . . . . . . . . . . . . . . . . . . . . .304.13.2, 403.1 23(1,1*3527(&7,9(6 Closers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.8 Door operation . . . . . . . . . . . . . . . . . . . . . . . 703.4.3 Hold-open devices . . . . . . . . . . . . . . . . . . . . . 703.4.2 Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . . .703.4 Signs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 703.4.1 Testing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.6 23(5$725 Definition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 25'(56HH127,&( 25',1$1&(58/( Applicability . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 Application for appeal. . . . . . . . . . . . . . . . . . . . .111.1 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 287/(7 Electrical. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .605.2 2:1(5 Closing of vacant structures . . . . . . . . . . . . . . . .108.2 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Demolition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Failure to comply . . . . . . . . . . . . . . . . . . . . . . . .110.3 Insect and rat control . . . . . . . . . .302.5, 309.2, 309.4 Notice . . . . . . . . . . . . . . . . . . . . . . . . . . . 107.1, 108.3 Pest elimination . . . . . . . . . . . . . . . . . . . . . . . . .309.2 Placarding of structure . . . . . . . . . . . . . . . . . . . .108.4 Responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . .301.2 Responsibility, fire safety . . . . . . . . . . . . . . . . . .701.2 Responsibility, light, ventilation. . . . . . . . . . . . . .401.2 Responsibility, mechanical and electrical. . . . . .601.2 Responsibility, plumbing facilities. . . . . . . . . . . .501.2 Right of entry . . . . . . . . . . . . . . . . . . . . . . . . . . .104.3 Rubbish storage . . . . . . . . . . . . . . . . . . . . . . . 308.2.1 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101.2 Transfer of ownership. . . . . . . . . . . . . . . . . . . . .107.6 3 3$66$*(:$< Common hall and stairway . . . . . . . . . . . . . . . . .402.2 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Toilet rooms, direct access. . . . . . . . . . . . . . . . .503.1 3(1$/7< Notices and orders . . . . . . . . . . . . . . . . . . . . . . .107.5 Placarding of structure . . . . . . . . . . . . . . . . . . . .108.4 Prohibited occupancy . . . . . . . . . . . . . . . . . . . . .108.5 Removal of placard. . . . . . . . . . . . . . . . . . . . . 108.4.1 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101.2 Violations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.4 3(67(/,0,1$7,21 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . .108.1 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Insect and rodent control 302.5, 304.5, 304.14, 309.1 Pest elimination . . . . . . . . . . . . . . . . . . . . . . . . .309.1 Responsibility of owner. . . . . . . . . . . . . . 301.2, 309.2 Responsibility of tenant-occupant.309.3, 309.4, 309.5 3/$&$5'3267 Closing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108.2 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . .108.1 Demolition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Emergency, notice . . . . . . . . . . . . . . . . . . . . . . .109.1 Notice to owner. . . . . . . . . . . . . . . . . . . . 107.1, 108.3 Placarding of structure . . . . . . . . . . . . . . . . . . . .108.4 Prohibited use. . . . . . . . . . . . . . . . . . . . . . . . . . .108.5 Removal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.4.1 3/80%,1* Clean and sanitary . . . . . . . . . . . . . . . . . . . . . . .504.1 Clearance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 504.2 Connections . . . . . . . . . . . . . . . . . . . . . . . . . . . 505.1 Contamination. . . . . . . . . . . . . . . . . . . . . . . . . . 505.2 Employee’s facilities . . . . . . . . . . . . . . . . . . . . . 503.3 Fixtures. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 504.1 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . . 502 Responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . 501.2 Sanitary drainage system . . . . . . . . . . . . . . . . . . . 506 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 501.1 Storm drainage . . . . . . . . . . . . . . . . . . . . . . . . . . . 507 Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505.3 Water heating facilities . . . . . . . . . . . . . . . . . . . 505.4 325&+ Handrails. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.12 Structurally sound. . . . . . . . . . . . . . . . . . . . . . 304.10 3257$%/(7(0325$5< Cooking equipment. . . . . . . . . . . . . . . . . . . . . . 603.1 35(6685( Water supply. . . . . . . . . . . . . . . . . . . . . . . . . . . 505.3 35,9$7(35,9$&< Bathtub or shower. . . . . . . . . . . . . . . . . . . . . . . 503.1 Occupancy limitations. . . . . . . . . . . . . . . . . . . . 404.1 Required plumbing facilities . . . . . . . . . . . . . . . . . 502 Sewage system. . . . . . . . . . . . . . . . . . . . . . . . . 506.1 Water closet and lavatory . . . . . . . . . . . . . . . . . 503.1 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . 505.1 3523(57<35(0,6(6 Cleanliness . . . . . . . . . . . . . . . . . . . . . . . 304.1, 308.1 Condemnation. . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Demolition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Emergency measures. . . . . . . . . . . . . . . . . . . . . . 109 Exterior areas . . . . . . . . . . . . . . . . . . . . . . . . . . . . 302 Failure to comply. . . . . . . . . . . . . . . . . . . . . . . . 110.3 Grading and drainage. . . . . . . . . . . . . . . . . . . . 302.2 Pest elimination, multiple occupancy . . . 302.5, 309.4 Pest elimination, single occupancy. . . . . 302.5, 309.3 Responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . 301.2 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.1 Storm drainage . . . . . . . . . . . . . . . . . . . . . . . . . . . 507 Vacant structures and land. . . . . . . . . . . . . . . . 301.3 3527(&7,21 Basement windows. . . . . . . . . . . . . . . . . . . . . 304.17 Fire protection systems. . . . . . . . . . . . . . . . . . . . . 704 Signs, marquees and awnings . . . . . . . . . . . . . 304.9 38%/,& Cleanliness . . . . . . . . . . . . . . . . . . . . . . . 304.1, 305.1 Egress. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 702.1 Hallway . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502.3 Sewage system. . . . . . . . . . . . . . . . . . . . . . . . . 506.1 Toilet facilities . . . . . . . . . . . . . . . . . . . . . . 502.5, 503 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Vacant structures and land . . . . . . . . . . . . . . . . 301.3 Water system. . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 38%/,&:$< Definition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 5 5$,135(9(17,212)(175<,172%8,/',1* (;7(5,25(19(/23( Basement hatchways. . . . . . . . . . . . . . . . . . . . 304.16 Exterior walls . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.6 Grading and drainage . . . . . . . . . . . . . . . . . . . . 302.2 Roofs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.7 Window and door frames. . . . . . . . . . . . . . . . . 304.13 5(&25' Official records. . . . . . . . . . . . . . . . . . . . . . . . . . 104.6 5(3$,5 Application of other codes . . . . . . . . . . . . . . . . . 102.3 Chimneys. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.11 Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110.1 Exterior surfaces . . . . . . . . . . . . . . . . . . . . . . . . 304.1 Intent . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.3 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.2 Signs, marquees and awnings. . . . . . . . . . . . . . 304.9 Stairs and porches. . . . . . . . . . . . . . . . . . . . . . 304.10 Weather tight . . . . . . . . . . . . . . . . . . . . . . . . . . 304.13 Workmanship. . . . . . . . . . . . . . . . . . . . . . . . . . . 102.5 5(32576 Test reports . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3.2 5(6,'(17,$/ Pest elimination . . . . . . . . . . . . . . . . . . . . . . . . . . 309 Residential heating . . . . . . . . . . . . . . . . . . . . . . 602.2 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 5(63216,%,/,7< Pest elimination . . . . . . . . . . . . . . . . . . . . . . . . . . 309 Fire safety . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 701.2 Garbage disposal. . . . . . . . . . . . . . . . . . . . . . . . 308.3 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.2 Mechanical and electrical . . . . . . . . . . . . . . . . . 601.2 Persons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.1 Placarding of structure. . . . . . . . . . . . . . . . . . . . 108.4 Plumbing facilities . . . . . . . . . . . . . . . . . . . . . . . 501.2 Rubbish storage. . . . . . . . . . . . . . . . . . . . . . . 308.2.1 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2, 301.1 5(92.(5(029( Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Existing remedies . . . . . . . . . . . . . . . . . . . . . . . 102.4 Removal of placard . . . . . . . . . . . . . . . . . . . . 108.4.1 Rubbish removal . . . . . . . . . . . . . . . . . . . . . . 308.2.1 5,*+72)(175< Duties and powers of code official. . . . . . . . . . . 104.3 Inspections. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.2 52'(176 Basement hatchways. . . . . . . . . . . . . . . . . . . .304.16 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Foundations . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.5 Guards for basement windows. . . . . . . . . . . . .304.17 Harborage . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.5 Insect and rodent control . . . . . . . . . . . . . . . . . .309.1 Pest elimination . . . . . . . . . . . . . . . . . . . . .302.5, 309 522) Exterior structure . . . . . . . . . . . . . . . . . . . . . . . .304.1 Roofs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.7 Storm drainage. . . . . . . . . . . . . . . . . . . . . . . . . . . 507 5220 Bedroom and living room. . . . . . . . . . . . . . . . . .404.4 Cooking facilities . . . . . . . . . . . . . . . . . . . . . . . .403.3 Direct access . . . . . . . . . . . . . . . . . . . . . . . . . . .503.2 Habitable . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .402.1 Heating facilities. . . . . . . . . . . . . . . . . . . . . . . . . . 602 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 Minimum ceiling heights. . . . . . . . . . . . . . . . . . .404.3 Minimum width. . . . . . . . . . . . . . . . . . . . . . . . . .404.2 Overcrowding. . . . . . . . . . . . . . . . . . . . . . . . . . .404.5 Prohibited use . . . . . . . . . . . . . . . . . . . . . . . . 404.4.4 Temperature. . . . . . . . . . . . . . . . . . . . . . . . . . . .602.5 Toilet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503 Ventilation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403 5220,1*+286(66HH'250,725< 58%%,6+ Accumulation . . . . . . . . . . . . . . . . . . . . . . . . . . .308.1 Definition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Disposal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .308.2 Garbage facilities . . . . . . . . . . . . . . . . . . . . . . 308.3.1 Rubbish storage. . . . . . . . . . . . . . . . . . . . . . . 308.2.1 6 6$)(7<6$)( Fire safety requirements . . . . . . . 701, 702, 703, 704 Safety controls . . . . . . . . . . . . . . . . . . . . . . . . . .603.4 6$1,7$5< Cleanliness. . . . . . . . . . . . . . . . . . . . . . . 304.1, 305.1 Disposal of garbage. . . . . . . . . . . . . . . . . . . . . .308.3 Disposal of rubbish. . . . . . . . . . . . . . . . . . . . . . .308.2 Exterior property areas. . . . . . . . . . . . . . . . . . . .302.1 Exterior structure . . . . . . . . . . . . . . . . . . . . . . . .304.1 Food preparation . . . . . . . . . . . . . . . . . . . . . . . .404.7 Furnished by occupant. . . . . . . . . . . . . . . . . . . .302.1 Grease interceptors . . . . . . . . . . . . . . . . . . . . . .506.3 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Plumbing fixtures . . . . . . . . . . . . . . . . . . . . . . . .504.1 Required plumbing facilities. . . . . . . . . . . . . . . . . 502 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101.2 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 6&5((16 Insect screens . . . . . . . . . . . . . . . . . . . . . . . . .304.14 6(&85,7< Basement hatchways . . . . . . . . . . . . . . . . . . 304.18.3 Building . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.18 Doors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.18.1 Vacant structures and land. . . . . . . . . . . . . . . . .301.3 Windows. . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.18.2 6(/)&/26,1*6&5((1'2256 Insect screens . . . . . . . . . . . . . . . . . . . . . . . . .304.14 6(3$5$7,21 Fire-resistance ratings . . . . . . . . . . . . . . . . . . . . . 703 Privacy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .404.1 Separation of units . . . . . . . . . . . . . . . . . . . . . . .404.1 6(59,&( Electrical. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .604.2 Method . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107.3 Notices and orders . . . . . . . . . . . . . . . . . 107.1, 108.3 Service on occupant. . . . . . . . . . . . . . . . . . . . . .108.3 6(:(5 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .506.1 Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . . .506.2 6+2:(5 Bathtub or shower . . . . . . . . . . . . . . . . . . . . . . .502.1 Rooming houses. . . . . . . . . . . . . . . . . . . . . . . . .502.2 Water-heating facilities . . . . . . . . . . . . . . . . . . . .505.4 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 6,*1 Fire door signs . . . . . . . . . . . . . . . . . . . . . . . . 703.4.1 Signs, marquees and awnings . . . . . . . . . . . . . .304.9 Unauthorized tampering . . . . . . . . . . . . . . . . . . .107.4 6,1*/()$0,/<':(//,1* Extermination . . . . . . . . . . . . . . . . . . . . . . . . . . . . 309 6,1. Kitchen sink . . . . . . . . . . . . . . . . . . . . . . . . . . . .502.1 Sewage system . . . . . . . . . . . . . . . . . . . . . . . . . . 506 Water supply. . . . . . . . . . . . . . . . . . . . . . . . . . . .505.3 6,=( Efficiency unit . . . . . . . . . . . . . . . . . . . . . . . . . . .404.6 Habitable room, light. . . . . . . . . . . . . . . . . . . . . . . 402 Habitable room, ventilation. . . . . . . . . . . . . . . . . . 403 Room area . . . . . . . . . . . . . . . . . . . . . . . . . . . 404.4.1 602.($/$506 Group R-1. . . . . . . . . . . . . . . . . . . . . . . . . . .704.6.1.1 Groups R-2, R-3, R-4 and I-1 . . . . . . . . . . . .704.6.1.2 Installation near bathrooms . . . . . . . . . . . . .704.6.1.4 Installation near cooking appliances. . . . . . .704.6.1.3 Interconnection . . . . . . . . . . . . . . . . . . . . . . . 704.6.2 Power source . . . . . . . . . . . . . . . . . . . . . . . . . 704.6.3 Testing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .704.7 Where required. . . . . . . . . . . . . . . . . . . . . . . . 704.6.1 63$&( General, light. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 General, ventilation. . . . . . . . . . . . . . . . . . . . . . . . 403 Occupancy limitations. . . . . . . . . . . . . . . . . . . . . . 404 Privacy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 404.1 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 401.1 67$&. Smoke. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.11 67$,56 Common halls and stairways, light . . . . . . . . . . 402.2 Exit facilities . . . . . . . . . . . . . . . . . . . . . . . . . . . 305.4 Exterior property areas . . . . . . . . . . . . . . . . . . . 302.3 Handrails. . . . . . . . . . . . . . . . . . . . . . . . 304.12, 305.5 Lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Stairs and porches . . . . . . . . . . . . . . . . . . . . . 304.10 67$1'$5' Referenced . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.7 6723:25.25'(5 Authority . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112.1 Emergencies. . . . . . . . . . . . . . . . . . . . . . . . . . . 112.3 Failure to comply. . . . . . . . . . . . . . . . . . . . . . . . 112.4 Issuance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112.2 6725$*( Food preparation. . . . . . . . . . . . . . . . . . . . . . . . 404.7 Garbage storage facilities. . . . . . . . . . . . . . . . . 308.3 Rubbish storage facilities . . . . . . . . . . . . . . . . 308.2.1 Sanitation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 308.1 6758&785( Accessory structures. . . . . . . . . . . . . . . . . . . . . 302.7 Closing of vacant structures . . . . . . . . . . . . . . . 108.2 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Emergency measures. . . . . . . . . . . . . . . . . . . . . . 109 General, condemnation. . . . . . . . . . . . . . . . . . . . . 110 General, exterior. . . . . . . . . . . . . . . . . . . . . . . . 304.1 General, interior structure. . . . . . . . . . . . . . . . . 305.1 Placarding of structure . . . . . . . . . . . . . . . . . . . 108.4 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.1 Structural members. . . . . . . . . . . . . . . . . 304.4, 305.2 Vacant structures and land. . . . . . . . . . . . . . . . 301.3 6833/< Combustion air . . . . . . . . . . . . . . . . . . . . . . . . . 603.5 Public water system . . . . . . . . . . . . . . . . . . . . . 505.1 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 Water supply. . . . . . . . . . . . . . . . . . . . . . . . . . . 505.3 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 685)$&( Exterior surfaces. . . . . . . . . . . . . . . . . . . 304.2, 304.6 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . 305.3 6:,00,1* Enclosure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 303.2 Safety covers . . . . . . . . . . . . . . . . . . . . . . . . . . 303.2 Swimming pools . . . . . . . . . . . . . . . . . . . . . . . . 303.1 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 7 7(03(5$785( Nonresidential structures. . . . . . . . . . . . . . . . . . 602.4 Residential buildings . . . . . . . . . . . . . . . . . . . . . 602.2 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 7(1$17 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 7(677(67,1* Agency. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3.1 Methods. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3.1 Reports . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3.2 Required . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3 72;,& Process ventilation. . . . . . . . . . . . . . . . . . . . . . . 403.4 75$6+ Rubbish and garbage . . . . . . . . . . . . . . . . . . . . . 308 8 812%6758&7(' Access to public way . . . . . . . . . . . . . . . . . . . . . 702.1 General, egress . . . . . . . . . . . . . . . . . . . . . . . . . 702.1 816$)(6758&785(6$1'(48,30(17 Abatement methods. . . . . . . . . . . . . . . . . . . . . . 108.6 Dangerous structure or premises . . . . . . . . . 108.1.5 Equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1.2 Existing remedies . . . . . . . . . . . . . . . . . . . . . . . 102.4 General, condemnation . . . . . . . . . . . . . . . . 108, 110 General, demolition . . . . . . . . . . . . . . . . . . . . . . . 110 Notices and orders. . . . . . . . . . . . . . . . . . . 107, 108.3 Record . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.7 Structures . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1.1 86( Application of other codes . . . . . . . . . . . . . . . . . 102.3 General, demolition . . . . . . . . . . . . . . . . . . . . . . . 110 87,/,7,(6 Authority to disconnect . . . . . . . . . . . . . . . . . 108.2.1 9 9$&$17 Abatement methods. . . . . . . . . . . . . . . . . . . . . . 108.6 Authority to disconnect service utilities . . . . . 108.2.1 Closing of vacant structures . . . . . . . . . . . . . . . 108.2 Emergency measure . . . . . . . . . . . . . . . . . . . . . . 109 Method of service . . . . . . . . . . . . . . . . . 107.3, 108.3 Notice to owner or to person responsible. . . . . . . . . . . . . . . . . 107, 108.3 Placarding of structure. . . . . . . . . . . . . . . . . . . . 108.4 Record . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.7 Vacant structures and land . . . . . . . . . . . . . . . . 301.3 9$325 Exhaust vents . . . . . . . . . . . . . . . . . . . . . . . . . . 302.6 9(+,&/(6 Inoperative . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.8 Painting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.8 9(17 Plumbing hazard . . . . . . . . . . . . . . . . . . . . . . . .504.3 Exhaust vents. . . . . . . . . . . . . . . . . . . . . . . . . . .302.6 Flue . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .603.2 9(17,/$7,21 Clothes dryer exhaust . . . . . . . . . . . . . . . . . . . .403.5 Combustion air. . . . . . . . . . . . . . . . . . . . . . . . . .603.5 Definition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 General, ventilation . . . . . . . . . . . . . . . . . . . . . . . 403 Habitable rooms. . . . . . . . . . . . . . . . . . . . . . . . .403.1 Process ventilation. . . . . . . . . . . . . . . . . . . . . . .403.4 Recirculation . . . . . . . . . . . . . . . . . . . . . 403.2, 403.4 Toilet rooms . . . . . . . . . . . . . . . . . . . . . . . . . . . .403.2 9(50,1 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Insect and rodent control . . . . . . . . . . . . . .302.5, 309 9(57,&$/6+$)76 Required enclosure . . . . . . . . . . . . . . . . . . . . . .703.7 9,2/$7,21 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Enforcement. . . . . . . . . . . . . . . . . . . . . . . . . . . .106.2 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106 Notice. . . . . . . . . . . . . . . . . . . . . . . . . . . . .107, 108.3 Separate offenses . . . . . . . . . . . . . . . . . . . . . . .106.4 Placarding of structure. . . . . . . . . . . . . . . . . . . .108.4 Prosecution . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.3 Strict liability offense . . . . . . . . . . . . . . . . .106.3, 202 Transfer of ownership . . . . . . . . . . . . . . . . . . . .107.6 : :$/. Sidewalks. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.3 :$// Accessory structures . . . . . . . . . . . . . . . . . . . . .302.7 Exterior surfaces . . . . . . . . . . . . . . . . . . 304.2, 304.6 Exterior walls . . . . . . . . . . . . . . . . . . . . . . . . . . .304.6 Foundation walls . . . . . . . . . . . . . . . . . . . . . . . .304.5 General, fire-resistance rating . . . . . . . . . . . . . .703.1 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Outlets required . . . . . . . . . . . . . . . . . . . . . . . . .605.2 Temperature measurement . . . . . . . . . . . . . . . .602.5 :$67( Disposal of garbage. . . . . . . . . . . . . . . . . . . . . .308.3 Disposal of rubbish. . . . . . . . . . . . . . . . . . . . . . .308.2 Garbage storage facilities . . . . . . . . . . . . . . . 308.3.1 :$7(5 Basement hatchways. . . . . . . . . . . . . . . . . . . .304.16 Connections. . . . . . . . . . . . . . . . . . . . . . . . . . . .506.1 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Contamination . . . . . . . . . . . . . . . . . . . . . . . . . .505.2 General, sewage . . . . . . . . . . . . . . . . . . . . . . . . . 506 General, storm drainage. . . . . . . . . . . . . . . . . . . . 507 General, water system . . . . . . . . . . . . . . . . . . . . . 505 Heating . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .505.4 Hotels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .502.3 Kitchen sink . . . . . . . . . . . . . . . . . . . . . . . . . . . .502.1 Nonpotable water reuse . . . . . . . . . . . .505.5, 505.5.1 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . . 502 Rooming houses. . . . . . . . . . . . . . . . . . . . . . . . .502.2 Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .505.3 System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 Toilet rooms . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503 Water-heating facilities . . . . . . . . . . . . . . . . . . . .505.4 :($7+(5&/,0$7( Heating facilities . . . . . . . . . . . . . . . . . . . . . . . . . . 602 :(('6 Noxious weeds . . . . . . . . . . . . . . . . . . . . . . . . . .302.4 :,'7+ Minimum room width . . . . . . . . . . . . . . . . . . . . .404.2 :,1'2: Emergency escape. . . . . . . . . . . . . . . . . . . . . . .702.4 Glazing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.13.1 Guards for basement windows. . . . . . . . . . . . .304.17 Habitable rooms . . . . . . . . . . . . . . . . . . . . . . . . .402.1 Insect screens . . . . . . . . . . . . . . . . . . . . . . . . .304.14 Interior surface . . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 Openable windows . . . . . . . . . . . . . . . . . . . . 304.13.2 Toilet rooms . . . . . . . . . . . . . . . . . . . . . . . . . . . .403.2 Ventilation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403 Weather tight . . . . . . . . . . . . . . . . . . . . . . . . . .304.13 Window and door frames . . . . . . . . . . . . . . . . .304.13 :25.0$16+,3 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102.5 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 People Helping People Build a Safer World® * Some restrictions apply. Speak with an ICC Member Services Representative for details. 16-12897 BENEFITS THAT WORK FOR YOU No matter where you are in your building career, put the benefits of ICC Membership to work for you! Membership in ICC connects you to exclusive I-Codes resources, continuing education opportunities and Members-Only benefits that include: · Free code opinions from I-Codes experts · Free I-Code book(s) or download to new Members* · Discounts on I-Code resources, training and certification renewal · Posting resumes and job search openings through the ICC Career Center · Mentoring programs and valuable networking opportunities at ICC events · Free benefits — Corporate and Governmental Members: Your staff can receive free ICC benefits too* · Savings of up to 25% on code books and training materials and more Put the benefits of ICC Membership to work for you and your career. Visit www.iccsafe.org/mem3 to join now or to renew your Membership. Or call 1-888-ICC-SAFE (422-7233), ext. 33804 to learn more today! Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ICC Plan Review Services… For the most detailed and precise Plan Reviews in the industry Ever wonder why code officials, architects and other building professionals value and accept ICC plan reviews? • Experience – Our I-Code experts have expertise in ALL the International Codes® (I-Codes®) • Detailed Report – identifies code deficiencies found • Complimentary re-review of reissued plans* Plus, ICC Plan Review Services has over 200 years of combined experience with applications of the codes, 6 registered design professionals on staff and 120 International Code Council Certifications, so you can be assured that ICC will deliver the most detailed and precise plan reviews in the industry. *Applies to “Complete Plan Review Services”. Contact ICC Plan Review staff for details. To get your plan review started now or to learn about disciplines reviewed, plan review options and more, visit www.iccsafe.org/plr4 or call 888-422-7233, x5577. 17-14096 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 People Helping People Build a Safer World® 17-14099 Looking for the missing piece? Solve the puzzle and advance your career with ICC University ICC University has been built from the ground up with you in mind. Take advantage of tools to help you better track and manage your career growth and professional development, including automatic CEU tracking and simplified search options to find code training. Plan for your future and manage your professional development from one, easy-to-use location. ICC University provides you with: • Simplified access to over 300 training options • Automatic CEU tracking to keep you on track for recertification • Robust curriculums that identify supporting courses, publications and exam study materials to assist you in preparing for certification exams and achieving your next professional milestone • The ability to purchase all courses, related publications and exam preparation materials – as well as register for certification exams – from a single screen • And more! www.iccsafe.org/ExploreICCU kk al ng anddg Plan for your Plan our ment from one,fme e,one Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 Valuable Guides to Changes in the 2018 I-Codes® SIGNIFICANT CHANGES TO THE 2018 INTERNATIONAL CODES® Practical resources that offer a comprehensive analysis of the critical changes made between the 2015 and 2018 editions of the codes. Authored by ICC code experts, these useful tools are “must-have” guides to the many important changes in the 2018 International Codes. Key changes are identified then followed by in-depth, expert discussion of how the change affects real world application. A full-color photo, table or illustration is included for each change to further clarify application. ORDER YOUR HELPFUL GUIDES TODAY! 1-800-786-4452 | www.iccsafe.org/books NEW! FULL COLOR! HUNDREDS OF PHOTOS AND ILLUSTRATIONS! HIRE ICC TO TEACH Want your group to learn the Significant Changes to the I-Codes from an ICC expert instructor? Schedule a seminar today! email: ICCTraining@iccsafe.org | phone: 1-888-422-7233 ext. 33818 SIGNIFICANT CHANGES TO THE IBC, 2018 EDITION #7024S18 SIGNIFICANT CHANGES TO THE IRC, 2018 EDITION #7101S18 SIGNIFICANT CHANGES TO THE IFC, 2018 EDITION #7404S18 SIGNIFICANT CHANGES TO THE IPC/IMC/IFGC, 2018 EDITION #7202S18 People Helping People Build a Safer World® 17-14098 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 AGENDA SECTION:OTHER BUSINESS AGENDA ITEM #5. STAFF RE P ORT NO. 31 CIT Y COUNCIL ME E T ING 2/11/2020 RE P O RT P RE PA RE D B Y: Lynnette C hambers, Multifamily Housing C oordinator D E PA RTME NT D IRE C TO R RE V IE W: John S tark, C ommunity D evelopment D irector 2/4/2020 O THE R D E PA RTM E NT RE V IE W: N/A C ITY MA NA G E R RE V IE W: K atie Rodriguez 2/5/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the approval of agreements with non-profit organizations to provide social services to the City of Richfield and authorization of the City Manager to execute agreements with those agencies. E X E C UT IV E S UM M ARY: The 2020 City Budget includes funding for organizations that provide social services that are deemed to be of benefit to the City and the community in general. The 2020 Budget includes $70,480 for this purpose. I n November 2019, staff distributed a Request for Proposals for Social Services to non-profit agencies serving the City of Richfield for services to be provided in 2020. A total of 10 proposals were received from the following agencies: Headway Emotional Health (The Storefront Group) Cornerstone Advocacy Services The Family Partnership Transportation Resources to Aid I ndependent Living (TRA I L) Volunteers Enlisted to Assist People (V E A P) Loaves and Fishes Y MC A Thrive Planned Parenthood Senior Community Services Modulo De I nformacion De Recursos Y Apoyo (MI RA) T he proposals represent a wide variety of social services offered to Richfield residents. T he organizations requested a total amount of $129,060, exceeding the City's available funding by $58,580. Two Richfield residents assisted in the review of proposals and subsequent funding recommendations. The review committee's recommendations took into account the type of service(s) to be provided, the target population(s) to be served, and past performance of the social service agency. Of the ten proposals received, two were not recommended for funding: Y MC A Thrive and Planned Parenthood. The following table details the review committee's recommendations: Organization 2020 Proposal Request 2020 Recommendation Headway/Storefront $12,000 $8,000 Cornerstone $15,000 $10,550 TRA I L $5,500 $4,000 V E A P $23,853 $21,230 Loaves and Fishes $10,000 $6,000 The Family Partnership $15,000 $10,000 Senior Community Services $10,000 $7,500 MI RA $3,207 $3,200 Y MC A Thrive $15,000 Planned Parenthood $20,000 TO TAL $129,060 $70,480 A complete overview of all services to be provided by the various organizations is attached. RE C O M M E ND E D AC T I O N: By motion: Approve the agreements between the recommended non-profit organizations and the City of Richfield, and authorize the City Manager to execute agreements for services with those agencies. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T T he City of Richfield has historically allocated funds on an annual basis to social service agencies serving the Richfield community. In 2012, the City was required to make changes to its funding practices due to independent audit findings, resulting in the discontinuation of grant funding to social service agencies beginning in 2013. T he City is not authorized to provide grant funding to social service agencies; however, it has been determined that the City can enter into agreements for services with agencies for specific services that are compatible with City activities. T he 2020 recommendations are based on the following criteria: Demonstrated need of the proposed service for the targeted population. Compatibility with City functions/activities. Partnership and/or assistance with various City services (e.g., public safety). Efforts to serve low-income persons of all races/cultures/ethnicity. Demonstrated value to the community. Past performance. Cost of services and number of persons served. Certified Non-Profit agency. T he following chart provides a eight-year history of the City of Richfield social service funding to the responding agencies (fields left blank indicate no proposal was made or proposal not funded): Organization 2012 2013 2014 2015 2016 2017 2018 2019 Headway $15,500 $12,000 $10,930 $8,000 $8,000 $8,000 $8,000 $9,000 Cornerstone $12,825 $12,000 $10,000 $12,000 $11,000 $12,980 $13,980 $12,500 People with C A P E S/Adv. for I ntentional Living $5,000 $7,500 $9,250 Comm. I nvolve. Program $6,475 $5,000 $3,000 $4,000 $4,000 TRA I L $2,125 $1,550 $1,550 $2,000 $3,000 $3,500 $4,000 $4,250 V E A P $15,500 $15,000 $18,000 $18,000 $16,000 $16,000 $19,250 $21,230 Loaves and Fishes $3,900 $5,000 $5,000 $7,480 $6,000 $7,500 $7,500 $8,000 Richfield R.E.A.D.Y. $2,325 $1,500 $2,000 $1,500 Family Partnership $11,625 $10,000 $7,000 $6,000 $6,980 $7,000 Senior Comm. Services $7,000 $7,000 $6,000 $6,000 $6,000 $7,000 $9,000 MI RA $11,625 $9,000 $8,000 $7,000 $3,000 $0 $0 $2,000 Richfield Family Stability Work Group $4,500 TO TAL $81,900 $76,550 $70,480 $70,480 $70,480 $70,480 $70,480 $70,480 B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): To partner with other agencies as warranted and practical to assist in the delivery of services to City residents. C.C R IT IC AL T IMIN G IS S U E S: Services are to be provided in the calendar year 2020. D.F IN AN C IAL IMPAC T: A City Council/Administration 2020 allocation of $70,480 is budgeted for social services. This funding has remained at the same level since 2014. The amount requested exceeded the City’s available funding by $58,580. Given the increased demand for 2020 funding, staff will evaluate funding levels and priorities during this year's budget process. E.L E GAL C ON S ID E R AT ION: The City Attorney has reviewed the agreements. ALTE R N AT IV E R E C O MME N D ATIO N(S): Approve the recommendations with revised allocations. Do not approve the recommendations. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: Representatives of the Social Service Agencies have been invited to attend. AT TAC H ME N T S: D escription Type 2020 D escription of S ervices C over Memo 2020 S ocial S ervices RF P C over Memo CITY OF RICHFIELD 2020 APPLICANT SERVICES DESCRIPTIONS FOR OTHER AGENCY DIVISION SOCIAL SERVICE FUNDING ASSISTANCE Agency-Program Description of Services Headway/The Storefront Group – Youth Counseling Program Provide outpatient services, community based counseling, case management, and supportive services to youth and families in Richfield. Modulo de Informacion, Recursos y Apoyo (MIRA) MIRA is committed to provide resource information, assistance and programs to meet the needs of Latino residents and other new immigrants, often in collaboration with other organizations. Beginning in 2017-2018, MIRA commenced a partnership with Richfield Community Education to expand Latino / immigrant outreach and participation in Community Education programs. Many of the classes and activities that MIRA provided independently in the past are now offered as part of the collaboration with Richfield Community Education. Other organizations utilizing MIRA’s community outreach services during the past year include Casa Esperanza (to organize Latino men’s groups) and Value of Five / Diversity Into Action Navigator (recruit Latino / immigrant participants in a Value of Five / DIA Navigator Job Fair). In addition to collaborations, MIRA hosts some events independently, including a family Reyes Magos (Three Kings) celebration in January, which is in its 7th year, and Feria de la Madre (Women’s Fair) in the Spring. This proposal focuses on expanding outreach services to Latinos and immigrants in Richfield, in collaboration with the City of Richfield. TRAIL (Transportation Resource to Aid Independent Living) – Transportation Services TRAIL will provide transportation to Richfield adults with developmental disabilities, allowing them to attend customized recreation and leisure programs offered by Adaptive Recreation and Learning Exchange (AR&LE). AR&LE offers recreation, leisure and community education opportunities specifically designed to meet the needs of people with disabilities in the cities of Richfield, Eden Prairie, Edina and Bloomington. Cornerstone Advocacy Service – Crisis Intervention Funding is to support Cornerstone’s full continuum of services. Cornerstone provides comprehensive services for Richfield residents who have experienced domestic violence, sexual violence, human trafficking and general crime. Cornerstone is a pioneer in developing primary prevention and early intervention programs for children and youth. Cornerstone offers crisis intervention services 24/7 and their emergency shelter provides safe refuge when a victim is in imminent danger of assault. Cornerstone provides assistance to victims needing to file an Order for Protection or Harassment Order without cost to that victim. Loaves & Fishes – meals, referrals, and advocacy services Serves nutritious meals to the hungry in the areas that need it most. The ultimate goal is to provide nourishment through food and community. Loaves and Fishes operate two dining sites, two summer sites for children when school is not in session, and a produce garden in Richfield: Hope Church (7132 Portland Avenue) and Woodlake Lutheran Church (7525 Oliver Avenue; the garden site is located at Woodlake Lutheran Church as well). The Summer Food Service Program is served at Hope Presbyterian Church and Woodlake Lutheran Church when school is not in session to children who qualify for free or reduced-cost school lunches. Senior Community Services Senior Outreach provides service/case management and supportive counseling to frail older adults and their caregivers to help senior remain as independent as possible and to assist caregivers in providing care while maintaining balance in their lives. VEAP (Volunteers Enlisted to Assist People) VEAP’s Social Services program’s primary goal is to create a path to stability for low-income individuals, seniors, youth, and families in the City of Richfield. The program strives to do this by providing food, financial, and supportive services that increase access to healthy food and stable housing, minimize or prevent crisis situations, and increase client resourcefulness. The Family Partnership The Family Partnership’s School-Linked Mental Health program provides one-to-one mental health therapy co-located within Richfield Public Schools. The program acts as a mental health resource for school staff, students, and parents, providing referrals as well as vital information on mental health. The Family Partnership’s School-Linked Mental Health program is currently in Richfield Middle School and Centennial Elementary with a possibility of expanding to the STEM Elementary School. CITY OF RICHFIELD REQUEST FOR PROPOSALS FOR SOCIAL SERVICES 2020 The City of Richfield is seeking proposals for social services from non-profit agencies serving the City of Richfield. Funding parameters and priority goals for the purpose of making the best use of funds are as follows: Funding Parameters • Any non-profit organization is eligible to apply. • Projects must serve Richfield residents. • Services must be compatible with City functions and activities. Priority Goals Projects must address at least one of the following areas: • Services for vulnerable senior residents. • Services for individuals, families, teens and/or children at risk. • Housing support services for low-income persons and persons at risk. Award Criteria Proposals must meet one or more of the following criteria: • Demonstrated need of the proposed service for the targeted population. • Compatibility with City functions/activities. • Partnership and/or assistance with various City services (i.e., public safety). • Efforts to serve low-income persons of all races/cultures/ethnicities. • Demonstrated value to the community. • Certified Non-Profit agency. Proposal’s must be submitted by 4:30 p.m. December 27, 2019 LATE PROPOSALS WILL NOT BE ACCEPTED Proposals must be submitted by 4:30 p.m. December 27, 2019 LATE PROPOSALS WILL NOT BE ACCEPTED PROPOSAL SUBMISSION INSTRUCTIONS The information requested in the attached Request for Proposals must be addressed in your proposal. Submit 1 electronic copy of your agencies proposal by 4:30 p.m. December 27, 2019 (LATE PROPOSALS WILL NOT BE ACCEPTED) to: Lynnette Chambers City of Richfield 6700 Portland Avenue Richfield, MN 55423 lchambers@richfieldmn.gov Applicants may be asked to respond in writing to additional questions. The Richfield City Council will tentatively award contracts for services in February 2020. Agencies awarded contracts will be required to sign a service agreement for calendar year 2020 and submit semi-annual reports on service outcomes. Please contact Lynnette Chambers at 612-861-9773 or lchambers@richfieldmn.gov with any questions. Proposals must be submitted by 4:30 p.m. December 27, 2019 LATE PROPOSALS WILL NOT BE ACCEPTED CITY OF RICHFIELD 2020 REQUEST FOR PROPOSALS FOR SOCIAL SERVICE ASSISTANCE Proposals for social services must include the following: PROPOSAL HEADING 1. Agency name, address, contact person, and phone/fax/email 2. Amount of request 3. Brief description of service(s) provided 4. Identify priority area(s) you are addressing: a) Services for vulnerable senior residents b) Services for individuals, families, teens and/or children at risk c) Housing support services for low-income persons and persons at risk d) Other: Please Specify 5. Explain how the services you are proposing to provide will benefit the City of Richfield. 6. Explain any formal or informal partnership you have with the City of Richfield (i.e., assisting Public Safety through the services you provide, etc.) ADMINISTRATION 1. Provide a mission statement for your agency. 2. Provide verification of your organization’s non-profit legal status. 3. Indicate your total agency budget for 2020. 4. Indicate your proposed project budget for 2020. Itemize proposed expenses and describe as applicable. Indicate both proposed City funds and other funds to support the project. PROGRAM 1. Describe service to be funded, including: a) Brief statement detailing the service and how it is provided b) Target population(s); estimated number of unduplicated individuals you plan to serve residing in the City of Richfield c) Eligibility criteria and process d) How clients are involved in the planning process for service e) Desired client outcomes and methods of evaluating and measuring client progress (use attached “Proposed Outcome/Evaluation Methods” form) 3. Demonstrate the need for the proposed service. 4. Describe outreach efforts to target populations, including immigrant and low-income individuals. Please contact Lynnette Chambers at 612-861-9773 or lchambers@richfieldmn.gov with any questions. Proposals must be submitted by 4:30 p.m. December 27, 2019 LATE PROPOSALS WILL NOT BE ACCEPTED City of Richfield Social Service Programs - 2020 Proposed Outcomes/Evaluation Methods Name of Applicant Organization: Address: Contact Person: Phone: Email: Brief description of service(s): Outcomes: State 3 to 5 measurable outcomes of proposed service(s) – relate outcomes to client progress Outcomes indicate what result, benefit, or change would come from the service provided. Outcomes can be: 1) initial, such as increased knowledge, understanding, or skills; 2) intermediate, such as change in a specific behavior or attitude; or 3) long term, such as a change in the condition or status of people. Indicators: Describe methods of evaluating proposed outcomes – how you will measure client progress