Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
01-28-2020 Regular Agenda
R EG U LAR C IT Y C O U N C IL MEET IN G R IC H F IE L D MU N IC IPAL C E N TE R, C O U N C IL C H AMB E R S J AN U ARY 28, 2020 7:00 P M R E G U L AR C ITY C O U N C IL ME E TIN G IN TR O D U C TO RY P R O C E E D IN G S C all to order P ledge of A llegiance A pproval of the Minutes of: (1) C ity C ouncil Work S ession of January 08, 2020; (2) S pecial C ity C ouncil Work S ession of January 11, 2020; (3) C ity C ouncil Work S ession of January 14, 2020; (4) C ity C ouncil Meeting of J anuary 14, 2020; and (5) S pecial C ity C ouncil Work S ession of J anuary 16, 2020. AG E N D A APPR O VAL 1.A pproval of the A genda 2.Consent Calendar contains several separate items, which are acted upon by the City Council in one motion. Once the Consent Calendar has been approved, the individual items and recommended actions have also been approved. No further Council action on these items is necessary. However, any Council Member may request that an item be removed from the Consent Calendar and placed on the regular agenda for Council discussion and action. All items listed on the Consent Calendar are recommended for approval. A .C onsider the approval of a Temporary On-S ale Intoxicating L iquor license for the C hurch of S t. P eter, located at 6730 Nicollet Avenue S outh, for their Ham B ingo event taking place on March 28, 2020. S taff Report No. 15 B .C onsider the approval of a Temporary On-S ale Intoxicating L iquor license for the C hurch of S t. P eter, located at 6730 Nicollet Avenue S outh, for their S paghetti D inner event taking place on F ebruary 16, 2020. S taff Report No. 16 C .C onsider the adoption of a resolution appointing election judges for the P residential Nomination P rimary of March 3, 2020 and approval of the absentee ballot board for the 2020 E lection cycle. S taff Report No. 17 D .F irst reading of an ordinance amending S ection 405 of the C ity C ode related to housing maintenance and adopting the International P roperty Maintenance C ode (IP M C ). S taff Report No. 18 E .C onsider the approval of a C onstruction and Maintenance A greement with Morrie's Richfield J RL RE , L L C (Morrie's Jaguar L and Rover) that defines ownership and maintenance responsibilities for certain features constructed at 1525 E ast 77th S treet. S taff Report No. 19 F.C onsider the approval of a C onstruction and Maintenance A greement with NO V O, L L C that defines ownership and maintenance responsibilities for certain features constructed at 2400 West 66th S treet. S taff Report No. 20 G.C onsider the approval of a C onstruction and Maintenance A greement with C hamberlain A partments, L L C that defines ownership and maintenance responsibilities for certain features constructed at 6630, 6700, and 6701 Richfield P arkway. S taff Report No. 21 3.C onsideration of items, if any, removed from C onsent C alendar PR O P O S E D O R D IN AN C E S 4.C onsider approval of an ordinance rezoning property at 6501 Woodlake D rive (Market P laza / Village S hores). C onsider approval of a resolution granting an amendment to the Market P laza / Village S hores planned unit development to allow a new building for a bank branch with a drive-up ATM. C onsider approval of a resolution granting a subdivision waiver to allow the creation of a separate lot for the proposed building. S taff Report No. 22 R E S O L U T IO N S 5.C onsider the approval of a resolution authorizing the lawful gambling premises permit for Minneapolis-Richfield A merican L egion P ost #435, 6501 P ortland Avenue S outh. S taff Report No. 23 6.C onsider a resolution to support the coordinated census efforts and funding to ensure that all Richfield residents are counted in the 2020 C ensus. S taff Report No. 24 7.Violation hearing and consideration of a resolution regarding civil enforcement for establishments that recently underwent alcohol compliance checks conducted by Richfield P ublic S afety staff, and failed by selling alcohol to underage youth. S taff Report No. 25 O T H E R B U S IN E S S 8.C onsider the appointments to C ity advisory commissions. S taff Report No. 26 C IT Y MAN AG E R’S R E P O R T 9.C ity Manager's Report C LAIMS AN D PAYR O L LS 10.C laims and P ayroll Open forum E ach speaker is to keep their comment period to three minutes to allow sufficient time for others. C omments are to be an opportunity to address the C ouncil on items not on the agenda. I ndividuals who wish to address the C ouncil must have registered prior to the meeting. C O U N C IL D ISC U SSIO N 11.Hats Off to Hometown Hits 12.A djournment Auxiliary aids for individuals with disabilities are available upon request. Requests must be made at least 96 hours in advance to the City Clerk at 612-861-9738. CITY COUNCIL MEETING MINUTES Richfield, Minnesota Special City Council Work Session January 08, 2020 CALL TO ORDER The work session was called to order by Council Member Regan Gonzalez at 4:35 p.m. in the Bartholomew Room. Council Members Maria Regan Gonzalez, Mayor; Edwina Garcia; Mary Supple; and Present: Ben Whalen Council Members Simon Trautmann Absent: Staff Present: Katie Rodriguez, City Manager; Pam Dmytrenko, Assistant City Manager; Neil Ruhland, Communications and Engagement Manager; Blanca Martinez Gavina, Executive Analyst. Item #1 STAFF WILL PROVIDE AN OVERVIEW OF THE SCHEDULE AND PROCESS FOR THE 2020 COMMUNITY SURVEY, INCLUDING OPTIONS FOR CUSTOM SURVEY QUESTIONS City Manager Rodriguez reviewed the timeline for the Community Survey and spoke of the key items such as options to expand sample size, the ability to offer the survey in Spanish and the ability to benchmark. She then introduced other staff present and asked for feedback and any additional preferences for questions. Council Member Supple stated that questions thirteen through sixteen brought up issues that are critical for the community and there is a need to do further research on them. Council Member Whalen asked about question thirteen and the option of an electronic newsletter and whether that is too specific and leaves out other forms of communication and if adding email is a possibility. Communications Manager Ruhland responded about future sources of communication and stated there are a variety of ways that departments communicate, there could be a review of information venues and that email could be added to the list. Council Member Whalen spoke of the special media outlets and the distinct knowledge gap of some residents. He believes it would be worthwhile to explore other options or have more specific special media outlets and adding the Sun Current as an option. Special Council Work Session Minutes -2- January 08, 2020 City Manager Rodriguez stated the National Research Center (NRC) could possibly add other options for residents to be able to connect. Mayor Regan Gonzalez questioned number thirteen and if those would be areas to add more resources into depending on how the community responded. City Manager Rodriguez replied they are attempting to record their preferences so there is not so much guessing. Mayor Regan Gonzalez requested clarification on question fifteen. City Manager Rodriguez explained they are trying to get feedback from their Sweet Streets campaign. Council Member Whalen requested the question be worded differently and how will results be dealt with if they come back as unsatisfied. City Manager Rodriguez will discuss with NRC about changing the wording. Council Member Whalen referenced question fourteen and asked if there are no other projects other than recreation projects. City Manager Rodriguez didn’t want to put recreation and streets projects in the same question because they are not comparable projects. Council Member Supple asked about the response rate of the survey. City Manager Rodriguez stated that it is a very low return rate and over 2,000 are being sent out in hopes of receiving 500 back. Communications Manager Ruhland explained most people will toss it out with junk mail if there is no incentive for filling it out. Council Member Whalen requested the option of purchasing a few gift cards for a drawing to be discussed. Mayor Regan Gonzalez questioned the information regarding health on residents and if there is an option to take them out or change some. Assistant City Manager Dmytrenko stated there are a few options around health services and this information can be attained through other means. Communications Manager Ruhland spoke of how important it is to collect demographic information in creating a good data analysis. Council Member Whalen referenced question eleven and what the point of the question is and why there is a jump from City of Richfield government to Federal government. City Manager Rodriguez agreed to follow up with NRC for a response. Mayor Regan Gonzalez questioned the statistical significance and the numbers needed. City Manager Rodriguez explained NRC will send out the survey along with three reminders and if the feedback numbers fall short, they will then weight it according to Richfield demographics such as age, race, gender, income, and ethnicity. Mayor Regan Gonzalez wondered if they could host a party or encourage community members to assist residents in filling out the surveys. Communications Manager Ruhland clarified the need for a truly random sample and reaching out directly to residents is not random sampling. Executive Analyst Gavina spoke of the Spanish version of the survey being available online. Mayor Regan Gonzalez asked about adding a question around organized trash hauling. City Manager Rodriguez stated she spoke to Director Amy Markle and she expressed there could be confusion with organized recycling and organics, which is different. Mayor Regan Gonzalez expressed her excitement to procced. Special Council Work Session Minutes -3- January 08, 2020 ADJOURNMENT The work session was adjourned by unanimous consent at 5:20 p.m. Date Approved: January 28, 2020 Maria Regan Gonzalez Mayor Kelly Wynn Katie Rodriguez Senior Office Assistant City Manager CITY COUNCIL MEETING MINUTES Richfield, Minnesota Special City Council Work Session January 11, 2020 CALL TO ORDER The work session was called to order by Council Member Regan Gonzalez at 9:00 a.m. in the Babcock Room. Council Members Maria Regan Gonzalez, Mayor; Edwina Garcia; Mary Supple; Simon Present: Trautmann; and Ben Whalen Staff Present: Katie Rodriguez, City Manager (9:00 a.m. to 12:00 p.m.) Item #1 MEETINGS WITH APPLICANTS OF THE CITY’S ADVISORY COMMISSIONS The City Council held meetings with the following applicants for appointment to City Advisory Boards and Commissions: Allysen Hoberg Kameron Murray Amanda Kueper Bryan Pynn Dan Edgerton Louis Dzierzak Kathleen Balaban Mejbah Ahmed Kara Skahen Cecilia Wright Fountia Thompson-Robinson Gregory Mangold Mary Stratton Janie Mork Carolyn Engeldinger Anje Mehr Hillary Neary Kimberly Shelton Jeremy Barthels Rhonda Rezac Stephanie Nwaudo David Benson Alyssa Sanden Sara Lundberg Heather MacDonald ADJOURNMENT The work session was adjourned by unanimous consent at 3:30 p.m. Date Approved: January 28, 2020 Maria Regan Gonzalez Mayor Kelly Wynn Katie Rodriguez Senior Office Assistant City Manager CITY COUNCIL MEETING MINUTES Richfield, Minnesota City Council Work Session January 14, 2020 CALL TO ORDER The work session was called to order by Mayor Maria Regan Gonzalez at 5:45 p.m. in the Bartholomew Room. Council Members Maria Regan Gonzalez, Mayor; Edwina Garcia; Simon Present: Trautmann; and Ben Whalen. Council Members Mary Supple Absent: Staff Present: Katie Rodriguez, City Manager; Kristin Asher, Public Works Director; Jack Broz, Transportation Engineer; Neil Ruhland, Communication and Engagement Manager; and Kelly Wynn, Senior Office Assistant. Others Present: April Crockett, MnDOT Metro District, West Area Manager Item #1 PRESENTATION OF I-494 PLANNING AND VISION HISTORY City Manager Rodriguez gave an overview of the meeting and what will be discussed. Director Asher explained that it will be a discussion of the vision. Transportation Engineer Broz described vision versus project and the overall timeline containing 494 between 169 and the MSP Airport. He then gave a history beginning in 1987 of the I- 494 corridor. Director Asher added information regarding the 2014 vision of the interchange at 35W and I- 494. Transportation Engineer Broz presented the 2014 vision layout along Penn Avenue and how it will be affected by the changes. He also spoke of utilizing the “Box Plan” to redirect traffic. Director Asher explained Penn and Lyndale are in the vision because of where their ramps touch down on I- 494. Transportation Engineer Broz then laid out the 2014 vision along Lyndale and 82nd Street. Director Asher described that the main goal is to eliminate weaving and merging to reduce vehicle accidents that is caused when ramps are placed too close together. Council Work Session -2- January 14, 2020 Transportation Engineer Broz spoke on the current vision information evaluation process including Phase 2 which involves I-494 mainline alternative and need for access reconfiguration. Council Member Trautmann questioned how the Box Plan fits into the project and how traffic flow will be impacted. April Crockett stated they have information regarding the traffic and would be more than happy to share at another time. Transportation Engineer Broz reviewed the 35W and I-494 interchange area alternatives. He then spoke of the Technical Advisory Committee (TAC) agreed with the full vision of that area. Transportation Engineer Broz read through the remaining timeline for Phase 2 and provided a progress update. Council Member W halen requested clarification that there is a need regarding the Portland Ave changes and how it will impact businesses. Director Asher confirmed that would be a project detail. Council Member Whalen asked about pedestrian access during and after construction over I- 494. Transportation Engineer Broz stated the number one goal is to have freeway working but not ignoring the pedestrian access. It is an important aspect of the project. A vision and funding need to be put into place before more concrete plans are formed. Council Member Trautmann questioned how Best Buy Corporate employees will be affected when not being able to easily access 35W south. Mayor Regan Gonzalez also asked how Best Buy Corporate has been involved. Transportation Engineer Broz explained that Best Buy Corporate has been involved in conversations. The main goal is make the freeway work more efficiently. Council Member Whalen requested clarification that in order to make the freeway work more efficiently is to attempt to remove vehicles, employees from Best Buy Corporate, from the freeway. Transportation Engineer Broz confirmed that those vehicles would then travel along the Box. Transportation Engineer Broz described how the reliever roadways are used instead of I-494. The improvements on I-494, including a MnPass lane, will take traffic off of 77th Street and American Boulevard. Council Member Whalen would like to know how much traffic on the reliever routes is through- traffic that will be moved onto the freeway. Transportation Engineer Broz confirmed research has been done on how the freeway will be impacted. Council Member Whalen then wanted to know if there is a ballpark of how much traffic that will be. Transportation Engineer Broz stated they do not have that information yet but it will be included in the next steps. Mayor Regan Gonzalez questioned what decision points will be coming to the Policy Advisory Committee (PAC) in the upcoming February meeting. April Crockett explained there are three areas, reconfiguration, main line, interchange, incorporated into the vision. Mayor Regan Gonzalez wanted to know how the TAC and the PAC connect with each other so conversations or decisions aren’t being missed by either group. Director Asher explained PAC meetings are surrounded on what was discussed at TAC meetings and what decisions need to be made. April Crockett also touched on each city affected by the I-494 project has a TAC and PAC and will be necessary for Council to be kept up to date for when the funding comes through and the project is able to begin. Council Work Session -3- January 14, 2020 Mayor Regan Gonzalez then asked if they will be requesting a vote from Council on the vision. Director Asher stated that was not the intention and the PAC will be making decisions regarding the vision. City Manager Rodriguez requested the Council Members share all their feedback with staff so it can be presented and discussed, as well as, decide if another work session is required. Transportation Engineer Broz stated a Council action is not required for the MnDOT process on the vision. Director Asher asked Council for questions. Council Member Whalen circled back to the area around Best Buy Headquarters that is still being studied. April Crockett explained MnDOT should have a lot of information and she will be in touch with the project team. Council Member Trautmann thanked staff for supplying the maps with context and written thoughts. They are exceedingly important in helping Council understand the vision and be comfortable with the decisions being made. Council Member Whalen confirmed he is ok with not having a more official vote and is confident in the representatives involved in TAC and PAC. Mayor Regan Gonzalez read comments supplied by Council Member Supple since she was unable to attend the meeting: 1. Concerned with the I-494 and 35W interchange and how many Best Buy Corporate employees will be affected by the change. 2. Impact of extra travel time on and through the Box to be thoroughly studied. 3. Would like to know how the air quality in Richfield will be affected with more vehicles sitting on city streets. Council Member Supple will support the vision with the following provisions: 1. The Cedar Underpass is funded. 2. Underline residual issues on Crosstown are dealt with since it will be the primary detour. 3. Local impacts are fully addressed and remediated. City Manager Rodriguez summed up the meeting with a reminder the next PAC meeting is in February. ADJOURNMENT The work session was adjourned by unanimous consent at 6:40 p.m. Date Approved: January 28, 2020 Maria Regan Gonzalez Mayor Council Work Session -4- January 14, 2020 Kelly Wynn Katie Rodriguez Senior Office Assistant City Manager CALL TO ORDER The meeting was called to order by Mayor Maria Regan Gonzalez at 7:01 p.m. in the Council Chambers. Council Members Maria Regan Gonzalez, Mayor; Edwina Garcia; Simon Trautmann; and Present: Ben Whalen. Council Members Mary Supple Absent: Staff Present: Katie Rodriguez, City Manager; Mary Tietjen, City Attorney; Neil Ruhland, Communications Manager; Chris Regis, Finance Director; Jay Henthorne, Police Chief; Mike Flaherty, Public Safety Deputy Chief; Jamie Maiser, Public Safety Administrative Aid; Jennifer Anderson, Support Services Supervisor; Amy Markle, Recreation Services Director; Kris Weiby, Facilities Manager; and Blanca Martinez Gavina, Executive Analyst. PLEDGE OF ALLEGIANCE Arrow of Light Den of Richfield Cub Scout Pack 3384 led the Pledge of Allegiance APPROVAL OF MINUTES M/Garcia, S/Trautmann to approve the minutes of the: (1) City Council Work Session for December 10, 2019; (2) City Council Meeting Minutes for December 10, 2019; and (3) Special City Council Meeting of December 18, 2019. Motion carried 4-0. Item #1 APPROVAL OF THE AGENDA M/Trautmann, S/Whalen to approve the agenda CITY COUNCIL MEETING MINUTES Richfield, Minnesota Regular Council Meeting January 14, 2020 Council Meeting Minutes -2- January 14, 2020 Motion carried 4-0. Item #2 CONSENT CALENDAR City Manager Rodriguez presented the consent calendar. A. Consider a resolution granting an amendment to approved development plans at Cedar Point Commons requesting approval of a standalone trash enclosure for the retail building at 1840 66th Street East (Staff Report No. 01). RESOLUTION NO. 11702 RESOLUTION APPROVING AN AMENDED FINAL DEVELOPMENT PLAN AND CONDITIONAL USE PERMIT FOR THE CEDAR POINT COMMONS PLANNED UNIT DEVELOPMENT B. Consider approval of the first reading of an ordinance rezoning property at 6501 Woodlake Drive (Market Plaza & Village Shores) as Planned Mixed Use (PMU) and schedule a second reading for January 28, 2020 (Staff Report No. 02). C. Consider approval of an agreement with the City of Bloomington for the provision of public health services for the City of Richfield for 2020 (Staff Report No. 03). D. Consider approval for Temporary On-Sale Intoxicating Liquor license for the Blessed Trinity Catholic School, located at Church of St. Richard, 7540 Penn Avenue South, for their 2020 Sno*ball Dance taking place February 8, 2020 (Staff Report No. 04). E. Consider approval to designate an Acting City Manager for 2020 (Staff Report No. 05). F. Consider the resolutions designating official depositories for the City of Richfield for 2020, including the approval of collateral (Staff Report No. 06). RESOLUTION NO. 11703 RESOLUTION DESIGNATING CERTAIN FINANCIAL INSTITUTIONS AS DEPOSITORIES FOR THE INVESTMENT OF CITY OF RICHFIELD FUNDS IN 2020 RESOLUTION NO. 11704 RESOLUTION DESIGNATING CERTAIN SAVING AND LOAN ASSOCIATIONS, BANKS AND CREDIT UNIONS AS DEPOSITORIES FOR THE DEPOSIT AND INVESTMENT OF CITY FUNDS IN 2020 RESOLUTION NO. 11705 RESOLUTION DESIGNATING U.S. BANK A DEPOSITORY OF FUNDS OF THE CITY OF RICHFIELD FOR THE YEAR 2020 G. Consider a resolution authorizing the use of credit cards by City employees otherwise authorized to make purchases on behalf of the City (Staff Report No. 07). RESOLUTION NO. 11706 RESOLUTION AUTHORIZING THE USE OF CREDIT CARDS BY CITY Council Meeting Minutes -3- January 14, 2020 EMPLOYEES OTHERWISE AUTHORIZED TO MAKE PURCHASES ON BEHALF OF THE CITY OF RICHFIELD FOR THE YEAR 2020 H. Consider a resolution designating an official newspaper for 2020 (Staff Report No. 08). RESOLUTION NO. 11707 RESOLUTION DESIGNATING AN OFFICIAL NEWSPAPER FOR 2020 M/Garcia, S/Trautmann to approve the consent calendar Motion carried 4-0. Item #3 CONSIDERATION OF ITEMS, IF ANY, REMOVED FROM CONSENT CALENDAR None Item #4 CONSIDERATION OF THE APPOINTMENT OF YOUTH MEMBERS TO CITY ADVISORY BOARD/COMMISSIONS (STAFF REPORT NO. 09) Council Member Whalen read Staff Report 09. M/Whalen, S/Trautmann to appoint youth members to City advisory board/commissions Mayor Regan Gonzalez explained to the present Cub Scouts how they can apply to be a youth commissioner when they turn 15. Motion carried 4-0. Item #5 CONSIDER A RESOLUTION APPROVING THE CONTRACT WITH POLICE OFFICERS AND DETECTIVES LELS LOCAL 123 FOR THE CONTRACT PERIOD JANUARY 1, 2020 THROUGH DECEMBER 31, 2021 AND AUTHORIZE THE CITY MANAGER TO EXECUTE THE AGREEMENT (STAFF REPORT NO. 10) Council Member Trautmann presented Staff Report 10. M/Trautmann, S/Whalen to consider a resolution approving the contract with the Police Officers and Detectives LELS Local 123 for the contract period January 1, 2020 through December 31, 2021 and authorize the City Manager to execute the agreement. Council Meeting Minutes -4- January 14, 2020 RESOLUTION NO. 11708 RESOLUTION APPROVING LABOR AGREEMENT BETWEEN THE CITY OF RICHFIELD AND LAW ENFORCEMENT LABOR SERVICES (LELS), LOCAL 123 BARGAINING UNIT FOR THE YEARS 2020 AND 2021 Motion carried 4-0. Item #6 CONSIDER A RESOLUTION APPROVING THE CONTRACT WITH THE INTERNATIONAL ASSOCIATION OF FIREFIGHTERS LOCAL 1215 FOR THE CONTRACT PERIOD JANUARY 1, 2020 THROUGH DECEMBER 31, 2021 AND AUTHORIZE THE CITY MANAGER TO EXECUTE THE AGREEMENT (STAFF REPORT NO. 11) Council Member Garcia read Staff Report 11. M/Garcia, S/Whalen to consider a resolution approving the contract with the International Association of Firefighters Local 1215 for the contract period January 1, 2020 through December 31, 2021 and authorize the City Manager to execute the agreement. RESOLUTION NO. 11709 RESOLUTION APPROVING LABOR AGREEMENT BETWEEN THE CITY OF RICHFIELD AND THE INTERNATIONAL ASSOCIATION OF FIREFIGHTERS (IAFF), LOCAL 1215 BARGAINING UNIT FOR THE YEAR 2020 AND 2021 Motion carried 4-0. Item #7 CONSIDER THE DESIGNATION OF A MAYOR PRO TEMPORE FOR 2020 (STAFF REPORT NO. 12) Mayor Regan Gonzalez presented Staff Report 12 and designated Council Member Trautmann as the Mayor Pro Tempore. M/Garcia, S/Whalen to designate Council Member Trautmann as the Mayor Pro Tempore for the year 2020. Motion carried 4-0. Item #8 CONSIDER REPRESENTATIVES TO SERVE AS THE 2020 LIAISONS TO VARIOUS LOCAL, REGIONAL AND STATE ORGANIZATIONS, AND CITY BOARDS AND COMMISSIONS (STAFF REPORT NO. 13) Mayor Regan Gonzalez read Staff Report 13 and reviewed the list of liaisons. Council Meeting Minutes -5- January 14, 2020 M/Regan Gonzalez, S/Trautmann to consider representatives to serve as the 2020 liaisons to various local, regional and state organizations, and City boards and commissions. Motion carried 4-0. Item #9 CONSIDER THE ACCEPTANCE OF BID MINUTES/TABULATION, DATED JANUARY 7, 2020, AWARD OF CONTRACT TO COMMERCIAL REFRIGERATION SYSTEMS, THE LOWEST BIDDER, IN THE AMOUNT OF $2,849,895.00 (MINUS 8% CONTIGENCY DURING CONSTRUCTION), AND THE AUTHORIZATION OF STAFF TO EXECUTE THE CONTRACT FOR THE RICHFIELD ICE ARENA REFRIGERATION PROJECT, MANAGED BY B32 ENGINEERING GROUP (STAFF REPORT NO. 14) Council Member Whalen presented Staff Report 14 and stated how the Richfield Ice Arena is in need of the update. He stated the process included extensive community outreach and this is the final step to the project. Director Markle spoke of how three companies submitted bids and with the amount the project will cost, they will also be able to upgrade the HVAC system, ADA upgrades, purchase of artificial turf and roof improvements. The work is to start in late March and scheduled to be done mid-September. M/Whalen, S/Garcia to consider the acceptance of bid minutes/tabulation, dated January 7, 2020, award of contract to Commercial Refrigeration Systems, the lowest bidder, in the amount of $2,849,895.00 (minus an 8% contingency during construction), and the authorization of staff to execute the contract for the Richfield Ice Arena Refrigeration Project, managed by B32 Engineering Group. Council Member Garcia praised Director Markle and Facilities Manager Weiby on their efforts to bring this project to life. Mayor Regan Gonzalez also commended staff on their work, especially the community engagement process and is excited what they will be able to do the upgrades. Council Member Trautmann applauded staff as well and is very much looking forward to all the upgrades. Motion carried 4-0 Item #10 CITY MANAGER’S REPORT City Manager Rodriguez had nothing to report. Item #11 CLAIMS AND PAYROLL M/Garcia, S/Whalen that the following claims and payrolls be approved: Council Meeting Minutes -6- January 14, 2020 U.S. Bank 12/24/19 A/P Checks: 283226 - 283646 $ 2,644,618.25 Payroll: 150812 – 151134 43129 - 43132 648,276.21 TOTAL $ 3,292,894.46 U.S. Bank 01/14/2020 A/P Checks 283647 – 284087 $ 2126,407.80 Payroll: 151135 – 151785 43133 – 43134 1,343,213.77 TOTAL $ 3,469,621.57 Motion carried 4-0. OPEN FORUM Bryan Milliard, South Minneapolis resident, stated that he does business in the City of Richfield and was present to show support for the Quinones family. He stated his opinion that the officers involved in the incident should not be on the streets while the investigation remains open. Kimberly Milliard, South Minneapolis resident, spoke of her discontent with the city and does not believe the police department is abiding by their mission. Wilmery Quinones, sister of Brian Quinones, requested information about the officer involved shooting. She wants to see the videos from the incident and wants the officers involved off the streets. She stated how she avoids the City of Richfield. Don Williams, Minnesota resident, spoke of his frustration and dissatisfaction with City Council and referenced the lack of action and transparency. Chara Blanch, Richfield resident, specified her disappointment in City Council. She also demanded to have the three officers involved out of the streets, an update to the use of force policy and for police body cameras to be implemented. Zeta Henry, Minneapolis resident, spoke of the loss of her brother in 2012 due to an officer involved shooting with Brooklyn Center Police Department. She expressed her concern of not being heard or being kept aware. Dean Aden, brother of Isak Aden, stated his discontent with the City approving the budget for the Richfield Ice Arena improvements instead of using the money for police body cameras. Sumaya Aden, sister of Isak Aden, spoke of her frustration with the City Council and how they have handled the officer involved shooting. Item #12 HATS OFF TO HOMETOWN HITS None Council Meeting Minutes -7- January 14, 2020 Item #13 ADJOURNMENT M/Garcia, S/Trautmann to adjourn the meeting at 8:10 p.m. Motion carried 3-0 Due to background noise, Council Member Whalen was not aware of the motion to adjourn the meeting until after the motion was carried and did not participate in the vote. Date Approved: January 28, 2020 Maria Regan Gonzalez Mayor Kelly Wynn Katie Rodriguez Senior Administrative Assistant City Manager CITY COUNCIL MEETING MINUTES Richfield, Minnesota Special City Council Work Session January 16, 2020 CALL TO ORDER The work session was called to order by Council Member Regan Gonzalez at 5:00 p.m. in the Babcock Room. Council Members Maria Regan Gonzalez, Mayor; and Ben Whalen Present: Council Members Mary Supple; Edwina Garcia; and Simon Trautmann Absent: Staff Present: Katie Rodriguez, City Manager Item #1 MEETINGS WITH APPLICANTS OF THE CITY’S ADVISORY COMMISSIONS The City Council held meetings with the following applicants for appointment to City Advisory Boards and Commissions: Jackie Harris Laura Durenberger-Grunow Mia Simpson Brittany Trushin Brian Shaw Kyle Schmidt Raye Black Joshua Suckow Joe McDermott Mara Glubka Gary Ness Harry Waller Ted Weidenbach Jeff Waller Lois Abraham Katrina DeVore Mollie O’Howard ADJOURNMENT The work session was adjourned by unanimous consent at 9:40 p.m. Date Approved: January 28, 2020 Maria Regan Gonzalez Mayor Kelly Wynn Katie Rodriguez Senior Office Assistant City Manager AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.A. STAFF RE P ORT NO. 15 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Jennifer A nderson, S upport S ervices Manager D E PA RTME NT D IRE C TO R RE V IE W: Jay Henthorne, P ublic S afety D irector/C hief of P olice 1/21/2020 O THE R D E PA RTM E NT RE V IE W: N/A C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the approval of a Temporary On-Sale Intoxicating Liquor license for the Church of St. Peter, located at 6730 Nicollet Avenue South, for their Ham Bingo event taking place on March 28, 2020. E X E C UT IV E S UM M ARY: On J anuary 07, 2020, the City received application materials for a Temporary On-Sale I ntoxicating Liquor license for the Church of St. Peter, located at 6730 Nicollet Avenue South, for their Ham Bingo event taking place on March 28, 2020. They will serve intoxicating liquor, wine and 3.2 percent malt liquor from 5:30 p.m. to 9:00 p.m. on Saturday, March 28, 2020. They will serve a hot meal and snacks for dinner. The Church of St. Peter has contacted food sanitarians from the City of Bloomington to ensure proper food handling practices are followed. The Director of Public Safety has reviewed all required information and documents and has found no basis for denial. RE C O M M E ND E D AC T I O N: By motion: Approve issuance of a Temporary On-Sale Intoxicating Liquor license for the Church of St. Peter, located at 6730 Nicollet Avenue South, for their Ham Bingo event taking place on March 28, 2020. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T The applicant has satisfied the following requirements for the issuance of this license: The required licensing fee has been paid. Proof of liquor liability insurance has been provided showing the Catholic Mutual Relief Society of America affording the coverage. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): Richfield City Code Section 1202.05 requires all applicants to comply with all of the provisions of this code, as well as the provisions of Minnesota Statute Chapter 340A. C.C R IT IC AL T IMIN G IS S U E S: There are no critical timing issues. D.F IN AN C IAL IMPAC T: The required licensing fees have been received. E.L E GAL C ON S ID E R AT ION: There are no legal considerations. ALTE R N AT IV E R E C O MME N D ATIO N(S): The Council could deny the approval of the Temporary On-Sale I ntoxicating Liquor license for Church of St, Peter. This would mean the applicant would not be able to serve intoxicating liquor, wine or 3.2 percent malt liquor; however, Public Safety has not found any basis for denial. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: Church of St. Peter staff has been notified of the date of this meeting. AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.B. STAFF RE P ORT NO. 16 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Jennifer A nderson, S upport S ervices Manager D E PA RTME NT D IRE C TO R RE V IE W: Jay Henthorne, P ublic S afety D irector/C hief of P olice 1/21/2020 O THE R D E PA RTM E NT RE V IE W: N/A C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the approval of a Temporary On-Sale Intoxicating Liquor license for the Church of St. Peter, located at 6730 Nicollet Avenue South, for their Spaghetti Dinner event taking place on February 16, 2020. E X E C UT IV E S UM M ARY: On J anuary 07, 2020, the City received application materials for a Temporary On-Sale I ntoxicating Liquor license for the Church of St. Peter, located at 6730 Nicollet Avenue South, for their Spaghetti Dinner event taking place on February 16, 2020. They will serve intoxicating liquor, wine and 3.2 percent malt liquor from 5:00 p.m. to 9:00 p.m. on Sunday, February 16, 2020. They will serve a hot meal and dessert for dinner. The Church of St. Peter has contacted food sanitarians from the City of Bloomington to ensure proper food handling practices are followed. The Director of Public Safety has reviewed all required information and documents and has found no basis for denial. RE C O M M E ND E D AC T I O N: By motion: Approve the issuance of a Temporary On-Sale Intoxicating Liquor license for the Church of St. Peter, located at 6730 Nicollet Avenue South, for their Spaghetti Dinner event taking place on February 16, 2020. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T The applicant has satisfied the following requirements for the issuance of this license: The required licensing fee has been paid. Proof of liquor liability insurance has been provided showing the Catholic Mutual Relief Society of America affording the coverage. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): Richfield City Code Section 1202.05 requires all applicants to comply with all of the provisions of this code, as well as the provisions of Minnesota Statute Chapter 340A. C.C R IT IC AL T IMIN G IS S U E S: The event takes place on February 16, 2020; therefore, consideration of the license is needed at the City Council's J anuary 28, 2020 meeting. D.F IN AN C IAL IMPAC T: The required licensing fees have been received. E.L E GAL C ON S ID E R AT ION: There are no legal considerations. ALTE R N AT IV E R E C O MME N D ATIO N(S): The Council could deny the approval of the Temporary On-Sale I ntoxicating Liquor license for the Church of St. Peter. This would mean the applicant would not be able to serve intoxicating liquor, wine or 3.2 percent malt liquor; however, Public Safety has not found any basis for denial. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: Church of St. Peter staff has been notified of the date of this meeting. AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.C. STAFF RE P ORT NO. 17 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: K ari S inning, D eputy C ity C lerk D E PA RTME NT D IRE C TO R RE V IE W: E lizabeth VanHoose, C ity C lerk 1/21/2020 O THE R D E PA RTM E NT RE V IE W: N/A C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the adoption of a resolution appointing election judges for the Presidential Nomination Primary of March 3, 2020 and approval of the absentee ballot board for the 2020 Election cycle. E X E C UT IV E S UM M ARY: The Presidential Nomination Primary (P NP) is on Tuesday, March 3, 2020. I t has been nearly three decades since the last P NP was held in Minnesota, and only four have been held in state history. The first was conducted in 1916, and the most recent occurred in 1992. I n 2016, the Minnesota legislature passed a law authorizing the use of a P NP once more, beginning in 2020. Precinct caucuses run by the political parties will still occur, but won’t deal with nominating candidates for president. T he City Clerk’s office is updating and verifying the City’s election judge availability list. All individuals who have previously served as an election judge, were on the list submitted to the County Auditor by the major political parties, or have expressed an interest in serving as an election judge were asked to complete an online election judge application. Election judges will be assigned to the precincts based on availability, party balance, and the number required for each election. RE C O M M E ND E D AC T I O N: By motion: Adopt a resolution to appoint election judges for the Presidential Nomination Primary of March 3, 2020 and approval of the absentee ballot board for the 2020 Election cycle. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T I n 2016, the Minnesota legislature passed a law authorizing the use of a P NP, beginning in 2020. Minnesota Statute 204B.21 Subd. 2 provides that election judges for precincts in a municipality shall be appointed by the governing body of the municipality and that the appointments be made at least 25 days before the election at which the election judges will serve. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): The City Council is required by State Statute to make election judge appointments at least 25 days prior to the election. The proposed resolution contains names of those qualified individuals who have indicated a willingness and ability to serve as an election judge for the P NP and absentee ballot board. C.C R IT IC AL T IMIN G IS S U E S: I f the City Council does not appoint election judges, the conduct of the election would not be valid. D.F IN AN C IAL IMPAC T: The Office of the Secretary of State (OS S) is responsible for reimbursing counties and cities for costs. The OS S will provide forms and we will provide an itemized list along with the forms to the OS S by 5/9/2020 and the OS S will reimburse Richfield by 6/8/2020. E.L E GAL C ON S ID E R AT ION: The City Council must appoint election judges to serve at these elections to comply with Minnesota Statute 204B.21, Subd. 2. The names come from a list of people who have indicated their interest in serving as an election judge to the County Auditor pursuant to the provisions of M.S. 204B.21 Subd. 1 and those who have previously served or indicated interest in serving. ALTE R N AT IV E R E C O MME N D ATIO N(S): None. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None AT TAC H ME N T S: D escription Type Resolution for E lection J udges and A bsentee B allot B oard Resolution L etter RESOLUTION NO. RESOLUTION APPOINTING ELECTION JUDGES FOR THE PRESIDENTIAL NOMINATION PRIMARY OF MARCH 3, 2020 AND APPROVAL OF THE ABSENTEE BALLOT BOARD FOR THE 2020 ELECTION CYCLE WHEREAS, a Presidential Nomination Primary will be held on Tuesday, March 3, 2020. WHEREAS, Minnesota Statute 204B.21 Subd. 2 provides that election judges for precincts in a municipality shall be appointed by the governing body of the municipality and that the appointments be made at least 25 days before the election at which the election judges will serve. WHEREAS, Minnesota Statutes 203B.121 provides for the appointment of qualified individuals to serve as the City of Richfield absentee ballot board under the direction of the election official. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Richfield, (1) that the following are hereby appointed as judges for said election and (2) the City Clerk is authorized to include all members appointed to the Hennepin County absentee ballot board, under the direction of the County Election Manager, to serve as members of the Richfield absentee ballot board. Elizabeth VanHoose Kari Sinning Yvonne Atkins Julie Smith Angela Faison Elle Cutter Jan Anderson Lizette Sanchez Lopez John Holter Marlys Solt Jorina Andrews Carol Athey Stephen Aus Barbara Bauer Rosalie Bjorkman Mary Boespflug Sara Boothe Sandra Bradley Christie Burke Milissa Carter Carrie Chillman Michele Cromer-Poiré Kirsten Croone Scott Dahlquist Sandra Decker Catherine Dinndorf Pema Dorjee Marguerite Dozois Cynthia Dubansky Dee Dee Edlund Liz Ekholm Carolyn Engeldinger Denise Famodu Sharon Foster Bridget Gaeleigh Joe Garcia Judith Goebel Rebecca Guarino Roger Guarino Adrienne Hayes Ruth Hiland Linda Hinz Janette Holter Marilyn Jacobson Christine Kelly Nancy Lindberg Allison Linsmeyer Carol Lowe Natalie Madgy Cynthia Mandl Arden Mathison Michele McGee Joshua Medley Richard Morey Sarah Musgrave Helen Nachicas Susan Nielsen Marilyn Nienkerk Cindy Norland Christopher Okey Kate Panke Carol Petkoff Monica Petrov Robert Rose Doris Rubenstein Maureen Scaglia Shannon Schmidt Anne Schuette Regan Sieck Mary Jane Steinhagen Brett Stursa Erika Telkamp Janet Thompson Suzanne Thorpe David Tufford Mary Jo Tuttle Sandra Walstrom Mark Wange Lois Webb-Bradford Mark Wegener Andrew Weston Elaine Wetsch Katie Williams Jared Wills Deborah Zierden James Alagna Donald Anderson Patricia Bailey Mary Barnes William Bednar Kenneth Boie Francie Fletcher Claire Gahler Duane Kallis Cynthia Kuntz Lawrence Martin Andrew May Isabelle Moulinier Marlene Odegard Gloria Olson Wanda Poston Jeffrey Rundgren Charles Strauch Roger Swanson Mark Tilc Lisa Wold Joyce Anderson John Ashmead Mary Ann Ashmead James Atkins Rosemary Bernau Linda Boyd Marjorie Cain Doris Christine David Clark Kathy Collias Ed Fletcher Gregory Frost Robert Hall Cheryl Hjortaas Margaret Horan Sita Johnson Thomas Keegan Claire Killian Jamie Lane Sharon Mattson Ivar Natins Linda Nemitz Brad Obert Ruby Olson Holly Rhodes Margaret Schow Lynn Schuster K. Lashel Solberg Cheryl Thiele Doris Thorson John Twisk Nancy Walstrom Bob Wells PASSED by the City Council of the City of Richfield, Minnesota this 28th day of January, 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.D. STAFF RE P ORT NO. 18 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Melissa P oehlman, A sst. C ommunity D evelopment D irector D E PA RTME NT D IRE C TO R RE V IE W: John S tark, C ommunity D evelopment D irector 1/23/2020 O THE R D E PA RTM E NT RE V IE W: Jennifer A nderson, S upport S ervices S upervisor C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/23/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: First reading of an ordinance amending Section 405 of the City Code related to housing maintenance and adopting the International Property Maintenance Code (IP MC). E X E C UT IV E S UM M ARY: I n order to protect public health, safety, and welfare, the City has established a number of housing maintenance standards. These regulations are generally found in Section 405 of the City Code and have been in place, in some form, since the early 1980s. I n 1998, the I nternational Code Council published its first I nternational Property Maintenance Code (I P MC). The I P MC establishes minimum requirements for the maintenance of existing buildings through model code regulations that contain clear and specific property maintenance and improvement provisions. Two states (New York and Virginia) and over 600 jurisdictions have adopted the I P MC with individual modifications, including at least 22 cities in Minnesota. The I P MC is updated on a 3-year cycle. The City's Housing I nspectors have long-desired the adoption of the I P MC, which provides clearer and more specific language than the City's current Housing Code. Adoption of the I P MC by reference, with the proposed minor amendments, will not change property maintenance requirements within the City, but rather will allow Housing I nspectors to cite specific and clear code language to property owners/managers and thereby provide better guidance and customer service. RE C O M M E ND E D AC T I O N: By motion: Approve a first reading of an ordinance amending Section 405 (Housing Code) of the City Code and adopting, by reference and as amended, the International Property Maintenance Code (IP MC). B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T See Executive Summary B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): Adoption of an ordinance amending City Code requires a first and second reading by the City Council. A second reading of the proposed ordinance has been scheduled for February 11, 2020. C.C R IT IC AL T IMIN G IS S U E S: None D.F IN AN C IAL IMPAC T: None E.L E GAL C ON S ID E R AT ION: The City Attorney as reviewed the proposed ordinance. ALTE R N AT IV E R E C O MME N D ATIO N(S): Reject the adoption of the I nternational Property Maintenance Code; existing Codes shall remain in place. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None AT TAC H ME N T S: D escription Type Ordinance Ordinance A mended IP MC E xhibit BILL NO. _____ AN ORDINANCE REPEALING SECTION 405 (HOUSING CODE) OF THE CITY CODE OF ORDINANCES AND ADOPTING THE INTERNATIONAL PROPERTY MAINTENANCE CODE WITH AMENDMENTS THE CITY OF RICHFIELD DOES ORDAIN: Section 1. Subsection 405 of the Richfield City Code relating to housing maintenance is hereby repealed and replaced as follows: Subsection 405.00. Purpose and policy. The purpose of this Section, which will be known as the housing maintenance code, is to protect the public health, safety, and welfare. This Section: a) Sets minimum standards for basic equipment and facilities, light, ventilation and heating, and minimum space, use, and location requirements; b) Determines the responsibilities of owners, operators, and residents of dwellings; and c) Provides for enforcement and penalties. 405.03. Adoption of International Property Maintenance Code. Subdivision 1. Adoption of IPMC. The International Property Maintenance Code (IPMC), 2018 Edition, published by the International Code Council, Inc., is adopted by reference, subject to the amendments set forth in Subdivision 2, below. Subd. 2. Amendments to IPMC. The IPMC is amended as follows: 101.1 Title. These regulations shall be known as the International Property Maintenance Code of the City of Richfield, hereinafter referred to as “this code.” 102.3 Application of other codes. Repairs, additions or alterations to a structure, or changes of occupancy, shall be done in accordance with the procedures and provisions of the International Building Code, International Existing Building Code, International Energy Conservation Code, International Fire Code, International Fuel Gas Code, International Mechanical Code, International Residential Code, International Plumbing Code and NFPA 70 the Minnesota State Building Code (MSBC), established pursuant to M.S. §§ 326B.101 to 326B.194, as adopted by the City. Nothing in this code shall be construed to cancel, modify or set aside any provision of the International Zoning Code City of Richfield Zoning Code. 102.3.1 Minnesota State Building Code substitution. Throughout this Code, all references to the “International Building Code” shall be struck and replaced with “Minnesota State Building Code.” 102.7 Referenced codes and standards. The codes and standards referenced in this code shall be those that are listed in Chapter 8 and considered part of the requirements of this code to the prescribed extent of each such reference and as further regulated in Sections 102.7.1 and 102.7.2. Where differences occur between provisions of this code and the MSBC, the MSBC shall apply. Exception: Where enforcement of a code provision would violate the conditions of the listing of the equipment or appliance, the conditions of the listing shall apply. [A] 102.7.1 Conflicts. Where conflicts occur between provisions of this code and the referenced standards, the provisions of this code shall apply. [A] 102.7.2 Provisions in referenced codes and standards. Where the extent of the reference to a referenced code or standard includes subject matter that is within the scope of this code, the provisions of this code, as applicable, shall take precedence over the provisions in the referenced code or standard. 103.1 General. The department of property maintenance inspection is hereby created and the executive official in charge thereof shall be known as the code official. The City Manager or his or her designee is responsible for administering the provisions of this code. Collectively, these designees shall be known as the Code Official. 103.5 Fees. The fees for activities and services performed by the department in carrying out its responsibilities under this code shall be as indicated in the following fee schedule: Appendix D of the Richfield City Code. 106.4 Violation penalties. Any person who shall violate a provision of this code, or fail to comply therewith, or with any of the requirements thereof, shall be prosecuted within the limits provided by state or local laws. Each day that a violation continues after due notice has been served shallmay be deemed a separate offense. 107.1 Notice to person responsible. Whenever the code official determines that there has been a violation of this code or has grounds to believe that a violation has occurred, notice shall be given in the manner prescribed in Sections 107.2 and 107.3 to the person responsible for the violations as specified in this code. Notices for condemnation procedures shall comply with Section 108.3. 107.2 Form. Such notice prescribed in Section 107.1 shall be in accordance with all of the following: 1. Be in writing. 2. Include a description of the real estate sufficient for identification. 3. Include a statement of the violation or violations and why the notice is being issued. 4. Include a correction order allowing a reasonable time to make the repairs and improvements required to bring the dwelling unit or structure into compliance with the provisions of this code. 5. Inform the property owner or owner’s authorized agent of the right to appeal. 6. Include a statement of the right to file a lien in accordance with Section 106.3. Section 108 Unsafe Structures and Equipment is deleted in its entirety. 111.1 Application for appeal. Any person directly affected by a decision of the code official or a notice or order listed under this code shall have the right to appeal to the board of appeals, provided that a written application under Section 320 of the city code. An application for appeal shall be based on a claim that the true intent of this code or the rules legally adopted thereunder have been incorrectly interpreted, the provisions of this code do not fully apply, or the requirements of this code are adequately satisfied by other means. 111.2 Membership of board is deleted in its entirety. 111.3 Notice of meeting is deleted in its entirety. 111.4 Open hearing is deleted in its entirety. 111.5 Postponed hearing is deleted in its entirety. 111.6 Board decision is deleted in its entirety. 111.7 Court review is deleted in its entirety. 111.8 Stays of enforcement is deleted in its entirety. Section 112 Stop Work Order is deleted in its entirety. 201.3 Terms defined in other codes. Where terms are not defined in this code and are defined in the International Building Code, International Existing Building Code, International Fire Code, International Fuel Gas Code, International Mechanical Code, International Plumbing Code, International Residential Code, International Zoning Code or NFPA 70 MSBC and the city code, such terms shall have the meanings ascribed to them in those codes. Section 202 General Definitions shall be amended as follows: Garbage. The animal or vegetable waste resulting from the handling, preparation, cooking and consumption of food. (Also see “Rubbish.” Garbage and Rubbish shall be taken to encompass both definitions herein.) Rubbish. Combustible and noncombustible waste materials, except garbage; the term shall include the residue from the burning of wood, coal, coke and other combustible materials, paper, rags, cartons, boxes, wood, excelsior, rubber, leather, tree branches, yard trimmings, tin cans, metals, mineral matter, glass, crockery and dust and other similar materials. (Also see “Garbage.” Rubbish and Garbage shall be taken to encompass both definitions herein.) 301.3 Vacant structures and land. Vacant structures and premises thereof or vacant land shall be maintained in a clean, safe, secure and sanitary condition as provided herein so as not to cause a blighting problem or adversely affect the public health or safety in Section 925.02 of the city code. 302.4 Weeds is deleted in its entirety. 302.5 Rodent harborage is deleted in its entirety. 302.9 Defacement of property. A person shall not willfully or wantonly damage, mutilate or deface any exterior surface of any structure or building on any private or public property by placing thereon any marking, carving or graffiti. It shall be the responsibility of the owner to restore said surface to an approved state of maintenance and repair within 48 hours or as designated by the code official. 304.2 Protective treatment. Exterior surfaces, including but not limited to, doors, door and window frames, cornices, porches, trim, balconies, decks and fences, shall be maintained in good condition. Exterior wood surfaces, other than decay-resistant woods, shall be protected from the elements and decay by painting or other protective covering or treatment. Peeling, flaking and chipped paint shall be eliminated and surfaces repainted if on more than 20% of one side of any surface or building. Siding and masonry joints, as well as those between the building envelope and the perimeter of windows, doors and skylights, shall be maintained weather resistant and water tight. Metal surfaces subject to rust or corrosion shall be coated to inhibit such rust and corrosion, and surfaces with rust or corrosion shall be stabilized and coated to inhibit future rust and corrosion. Oxidation stains shall be removed from exterior surfaces. Surfaces designed for stabilization by oxidation are exempt from this requirement. 304.14 Insect screens. During the period from [date] to [date], every Every door, window and other outside opening required for ventilation of habitable rooms, food preparation areas, food service areas or any areas where products to be included or utilized in food for human consumption are processed, manufactured, packaged or stored shall be supplied with approved tightly fitting screens of minimum 16 mesh per inch (16 mesh per 25mm), and every screen door used for insect control shall have a self-closing device in good working condition. Subsections 308.1 – 308.3 related to rubbish and garbage are replaced in their entirety as follows: 308.1 Disposal of garbage or rubbish. The City of Richfield reserves the right to utilize the enforcement and notice processes in Section 601 of the Richfield City Code for garbage, yard waste, and recyclables preparation, collection, and disposal, scavenging, and air pollution. 602.3 Heat supply. Every owner and operator of any building who rents, leases or lets one or more dwelling units or sleeping units on terms, either expressed or implied, to furnish heat to the occupants thereof shall supply heat during the period from September 15 to May 15 to maintain a minimum temperature of 68°F (20°C) in all habitable rooms, bathrooms and toilet rooms. Exceptions: 1. When the outdoor temperature is below the winter outdoor design temperature for the locality, maintenance of the minimum room temperature shall not be required provided that the heating system is operating at its full design capacity. The winter outdoor design temperature for the locality shall be as indicated in Appendix D of the International Plumbing Code. 2. In areas where the average monthly temperature is above 30°F (-1°C), a minimum temperature of 65°F (18°C) shall be maintained. 602.4 Occupiable work spaces. Indoor occupiable work spaces shall be supplied with heat during the period from September 15 to May 15 to maintain a minimum temperature of 65°F (18°C) during the period the spaces are occupied. Exceptions: 1. Processing, storage and operation areas that require cooling or special temperature conditions. 2. Area in which persons are primarily engaged in vigorous physical activities. 703.7 Vertical shafts is deleted in its entirety. Sec. 2. This Ordinance will be effective in accordance with Section 3.09 of the City Charter. Passed by the City Council of the City of Richfield, Minnesota this 11th day of February, 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk 100727338 222 020 1 8 INTERNATIO NAL CODES ® Get a free 45-day online subscription to ICC’s premiumACCESS™ 2018 I-Codes Complete Collection. Test drive many powerful, time-saving tools available to you from premiumACCESS. To activate your bonus, visit www.iccsafe.org/codebonus. 2018 I-CODE BONUS OFFER INTERNATIONAL PROPERTY MAINTENANCE CODE® IPMC ® A Member of the International Code Family® Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,QWHUQDWLRQDO3URSHUW\0DLQWHQDQFH&RGH® )LUVW3ULQWLQJ$XJXVW ,6%1VRIWFRYHUHGLWLRQ &23<5,*+7¤ E\ ,17(51$7,21$/&2'(&281&,/,1& 'DWHRI)LUVW3XEOLFDWLRQ$XJXVW $//5,*+765(6(59('7KLV,QWHUQDWLRQDO3URSHUW\0DLQWHQDQFH&RGH®LVDFRS\ULJKWHGZRUNRZQHGE\WKH,QWHUQD WLRQDO&RGH&RXQFLO,QF:LWKRXWDGYDQFHZULWWHQSHUPLVVLRQIURPWKHFRS\ULJKWRZQHUQRSDUWRIWKLVERRNPD\EHUHSUR GXFHGGLVWULEXWHGRUWUDQVPLWWHGLQDQ\IRUPRUE\DQ\PHDQVLQFOXGLQJZLWKRXWOLPLWDWLRQHOHFWURQLFRSWLFDORUPHFKDQLFDO PHDQVE\ZD\RIH[DPSOHDQGQRWOLPLWDWLRQSKRWRFRS\LQJRUUHFRUGLQJE\RULQDQLQIRUPDWLRQVWRUDJHUHWULHYDOV\VWHP)RU LQIRUPDWLRQRQXVHULJKWVDQGSHUPLVVLRQVSOHDVHFRQWDFW3XEOLFDWLRQV)ORVVPRRU5RDG&RXQWU\&OXE+LOOV,/ 3KRQH,&&6$)( 7UDGHPDUNV³,QWHUQDWLRQDO&RGH&RXQFLO´WKH³,QWHUQDWLRQDO&RGH&RXQFLO´ORJR³,&&´WKH³,&&´ORJR³,QWHUQDWLRQDO3URS HUW\0DLQWHQDQFH&RGH´³,30&´DQGRWKHUQDPHVDQGWUDGHPDUNVDSSHDULQJLQWKLVERRNDUHWUDGHPDUNVRIWKH,QWHUQDWLRQDO &RGH&RXQFLO,QFDQGRULWVOLFHQVRUVDVDSSOLFDEOHDQGPD\QRWEHXVHGZLWKRXWSHUPLVVLRQ 35,17(',17+(86$ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'(LLL PREFACE Introduction The International Property Maintenance Code£ (IPMC£) establishes minimum requirements for the maintenance of existing buildings through model code regulations that contain clear and spe- cific property maintenance and property improvement provisions. This 2018 edition is fully com- patible with all of the International Codes£ (I-Codes£) published by the International Code Council£ (ICC£), including the International Building Code£, International Energy Conservation Code£, International Existing Building Code£, International Fire Code£, International Fuel Gas Code£, International Green Construction Code£, International Mechanical Code£, International Plumbing Code£, International Private Sewage Disposal Code£, International Residential Code£, International Swimming Pool and Spa Code£, International Wildland-Urban Interface Code£, Inter- national Zoning Code£ and International Code Council Performance Code£. The I-Codes, including this International Property Maintenance Code, are used in a variety of ways in both the public and private sectors. Most industry professionals are familiar with the I-Codes as the basis of laws and regulations in communities across the U.S. and in other countries. However, the impact of the codes extends well beyond the regulatory arena, as they are used in a variety of nonregulatory settings, including: • Voluntary compliance programs such as those promoting sustainability, energy efficiency and disaster resistance. • The insurance industry, to estimate and manage risk, and as a tool in underwriting and rate decisions. • Certification and credentialing of individuals involved in the fields of building design, con- struction and safety. • Certification of building and construction-related products. • U.S. federal agencies, to guide construction in an array of government-owned properties. • Facilities management. • “Best practices” benchmarks for designers and builders, including those who are engaged in projects in jurisdictions that do not have a formal regulatory system or a governmental enforcement mechanism. • College, university and professional school textbooks and curricula. • Reference works related to building design and construction. In addition to the codes themselves, the code development process brings together building pro- fessionals on a regular basis. It provides an international forum for discussion and deliberation about building design, construction methods, safety, performance requirements, technological advances and innovative products. Development This 2018 edition presents the code as originally issued, with changes reflected in the 2003 through 2015 editions and further changes developed through the ICC Code Development Process through 2016. A new edition of the code is promulgated every 3 years. This code is intended to establish provisions that adequately protect public health, safety and welfare; that do not unnecessarily increase construction costs; that do not restrict the use of new materials, products or methods of construction; and that do not give preferential treatment to par- ticular types or classes of materials, products or methods of construction. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 LY ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Maintenance The International Property Maintenance Code is kept up to date through the review of proposed changes submitted by code enforcement officials, industry representatives, design professionals and other interested parties. Proposed changes are carefully considered through an open code development process in which all interested and affected parties may participate. The ICC Code Development Process reflects principles of openness, transparency, balance, due process and consensus, the principles embodied in OMB Circular A-119, which governs the federal government’s use of private-sector standards. The ICC process is open to anyone; there is no cost to participate, and people can participate without travel cost through the ICC’s cloud-based app, cdp- Access£. A broad cross section of interests are represented in the ICC Code Development Process. The codes, which are updated regularly, include safeguards that allow for emergency action when required for health and safety reasons. In order to ensure that organizations with a direct and material interest in the codes have a voice in the process, the ICC has developed partnerships with key industry segments that support the ICC’s important public safety mission. Some code development committee members were nomi- nated by the following industry partners and approved by the ICC Board: • American Institute of Architects (AIA) • National Association of Home Builders (NAHB) The code development committees evaluate and make recommendations regarding proposed changes to the codes. Their recommendations are then subject to public comment and council-wide votes. The ICC’s governmental members—public safety officials who have no financial or business interest in the outcome—cast the final votes on proposed changes. The contents of this work are subject to change through the code development cycles and by any governmental entity that enacts the code into law. For more information regarding the code devel- opment process, contact the Codes and Standards Development Department of the International Code Council. While the I-Code development procedure is thorough and comprehensive, the ICC, its members and those participating in the development of the codes disclaim any liability resulting from the publication or use of the I-Codes, or from compliance or noncompliance with their provisions. The ICC does not have the power or authority to police or enforce compliance with the contents of this code. Code Development Committee Responsibilities (Letter Designations in Front of Section Numbers) In each code development cycle, proposed changes to this code are considered at the Committee Action Hearings by the International Property Maintenance Code Development Committee, whose action constitutes a recommendation to the voting membership for final action on the proposed changes. Proposed changes to a code section having a number beginning with a letter in brackets are considered by a different code development committee. For example, proposed changes to code sections that have the letter [F] in front of them (e.g., [F] 704.1) are considered by the Interna- tional Fire Code Development Committee at the Committee Action Hearings. The content of sections in this code that begin with a letter designation is maintained by another code development committee in accordance with the following: [A] = Administrative Code Development Committee; [F] = International Fire Code Development Committee; [P] = International Plumbing Code Development Committee; [BE] = IBC—Egress Code Development Committee; and [BG]= IBC—General Code Development Committee. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'(Y For the development of the 2021 edition of the I-Codes, there will be two groups of code devel- opment committees and they will meet in separate years. Code change proposals submitted for code sections that have a letter designation in front of them will be heard by the respective committee responsible for such code sections. Because differ- ent committees hold Committee Action Hearings in different years, proposals for the IPMC will be heard by committees in both the 2018 (Group A) and the 2019 (Group B) code development cycles. For instance, every section of Chapter 1 of this code is designated as the responsibility of the Administrative Code Development Committee, which is part of the Group B portion of the hearings. This committee will hold its Committee Action Hearings in 2019 to consider code change proposals for Chapter 1 of all I-Codes except the International Energy Conservation Code, International Resi- dential Code and International Green Construction Code. Therefore, any proposals received for Chapter 1 of this code will be assigned to the Administrative Code Development Committee for con- sideration in 2019. It is very important that anyone submitting code change proposals understand which code devel- opment committee is responsible for the section of the code that is the subject of the code change proposal. For further information on the code development committee responsibilities, please visit the ICC website at www.iccsafe.org/scoping. Group A Codes (Heard in 2018, Code Change Proposals Deadline: January 8, 2018) Group B Codes (Heard in 2019, Code Change Proposals Deadline: January 7, 2019) International Building Code – Egress (Chapters 10, 11, Appendix E) – Fire Safety (Chapters 7, 8, 9, 14, 26) – General (Chapters 2–6, 12, 27–33, Appendices A, B, C, D, K, N) Administrative Provisions (Chapter 1 of all codes except IECC, IRC and IgCC, administra- tive updates to currently referenced stan- dards, and designated definitions) International Fire Code International Building Code – Structural (Chapters 15–25, Appendices F, G, H, I, J, L, M) International Fuel Gas Code International Existing Building Code International Mechanical Code International Energy Conservation Code— Commercial International Plumbing Code International Energy Conservation Code— Residential – IECC—Residential – IRC—Energy (Chapter 11) International Property Maintenance Code International Green Construction Code (Chapter 1) International Private Sewage Disposal Code International Residential Code – IRC—Building (Chapters 1–10, Appendices E, F, H, J, K, L, M, O, Q, R, S, T) International Residential Code – IRC—Mechanical (Chapters 12–23) – IRC—Plumbing (Chapters 25–33, Appendices G, I, N, P) International Swimming Pool and Spa Code International Wildland-Urban Interface Code International Zoning Code Note: Proposed changes to the ICC Performance Code¥ will be heard by the code development committee noted in brack- ets [ ] in the text of the ICC Performance Code¥. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 YL ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Marginal Markings Solid vertical lines in the margins within the body of the code indicate a technical change from the requirements of the 2015 edition. Deletion indicators in the form of an arrow ( ) are provided in the margin where an entire section, paragraph, exception or table has been deleted or an item in a list of items or a table has been deleted. Coordination of the International Codes The coordination of technical provisions is one of the strengths of the ICC family of model codes. The codes can be used as a complete set of complementary documents, which will provide users with full integration and coordination of technical provisions. Individual codes can also be used in subsets or as stand-alone documents. To make sure that each individual code is as complete as pos- sible, some technical provisions that are relevant to more than one subject area are duplicated in some of the model codes. This allows users maximum flexibility in their application of the I-Codes. Italicized Terms Words and terms defined in Chapter 2, Definitions, are italicized where they appear in code text and the Chapter 2 definition applies. Where such words and terms are not italicized, common-use defi- nitions apply. The words and terms selected have code-specific definitions that the user should read carefully to facilitate better understanding of the code. Adoption The International Code Council maintains a copyright in all of its codes and standards. Maintaining copyright allows the ICC to fund its mission through sales of books, in both print and electronic for- mats. The ICC welcomes adoption of its codes by jurisdictions that recognize and acknowledge the ICC’s copyright in the code, and further acknowledge the substantial shared value of the public/pri- vate partnership for code development between jurisdictions and the ICC. The ICC also recognizes the need for jurisdictions to make laws available to the public. All I- Codes and I-Standards, along with the laws of many jurisdictions, are available for free in a nondownloadable form on the ICC’s website. Jurisdictions should contact the ICC at adop- tions@iccsafe.org to learn how to adopt and distribute laws based on the International Prop- erty Maintenance Code in a manner that provides necessary access, while maintaining the ICC’s copyright. To facilitate adoption, several sections of this code contain blanks for fill-in information that needs to be supplied by the adopting jurisdiction as part of the adoption legislation. For this code, please see: Section 101.1. Insert: [NAME OF JURISDICTION] Section 103.5. Insert: [APPROPRIATE SCHEDULE] Section 112.4. Insert: [DOLLAR AMOUNT IN TWO LOCATIONS] Section 302.4. Insert: [HEIGHT IN INCHES] Section 304.14. Insert: [DATES IN TWO LOCATIONS] Section 602.3. Insert: [DATES IN TWO LOCATIONS] Section 602.4. Insert: [DATES IN TWO LOCATIONS] Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'(YLL EFFECTIVE USE OF THE INTERNATIONAL PROPERTY MAINTENANCE CODE The International Property Maintenance Code (IPMC) is a model code that regulates the minimum maintenance requirements for existing buildings. The IPMC is a maintenance document intended to establish minimum maintenance standards for basic equipment, light, ventilation, heating, sanitation and fire safety. Responsibility is fixed among owners, operators and occupants for code compliance. The IPMC provides for the regulation and safe use of existing structures in the interest of the social and economic welfare of the community. Arrangement and Format of the 2018 IPMC Before applying the requirements of the IPMC it is beneficial to understand its arrangement and for- mat. The IPMC, like other codes published by ICC, is arranged and organized to follow sequential steps that generally occur during an inspection. The IPMC is divided into eight different parts: The following is a chapter-by-chapter synopsis of the scope and intent of the provisions of the Inter- national Property Maintenance Code: Chapter 1 Scope and Administration. This chapter contains provisions for the application, enforcement and administration of subsequent requirements of the code. In addition to establish- ing the scope of the code, Chapter 1 identifies which buildings and structures come under its pur- view. Chapter 1 is largely concerned with maintaining “due process of law” in enforcing the property maintenance criteria contained in the body of the code. Only through careful observation of the administrative provisions can the building official reasonably expect to demonstrate that “equal protection under the law” has been provided. Chapter 2 Definitions. All terms that are defined in the code are listed alphabetically in Chapter 2. While a defined term may be used in one chapter or another, the meaning provided in Chapter 2 is applicable throughout the code. Where understanding of a term’s definition is especially key to or necessary for understanding of a particular code provision, the term is shown in italics. This is true only for those terms that have a meaning that is unique to the code. In other words, the generally understood meaning of a term or phrase might not be sufficient or consistent with the meaning prescribed by the code; therefore, it is essential that the code-defined meaning be known. Guidance is provided regarding tense, gender and plurality of defined terms as well as terms not defined in this code. Chapters Subjects 1 Scope and Administration 2 Definitions 3 General Requirements 4 Light, Ventilation and Occupancy Limitations 5 Plumbing Facilities and Fixture Requirements 6 Mechanical and Electrical Requirements 7 Fire Safety Requirements 8 Referenced Standards Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 YLLL ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Chapter 3 General Requirements. Chapter 3, “General Requirements,” is broad in scope. It includes a variety of requirements for the exterior property areas as well as the interior and exterior elements of the structure. This chapter provides requirements that are intended to maintain a min- imum level of safety and sanitation for both the general public and the occupants of a structure, and to maintain a building’s structural and weather-resistance performance. Chapter 3 provides specific criteria for regulating the installation and maintenance of specific building components; mainte- nance requirements for vacant structures and land; requirements regulating the safety, sanitation and appearance of the interior and exterior of structures and all exterior property areas; accessory structures; vehicle storage regulations and establishes who is responsible for complying with the chapter’s provisions. This chapter also contains the requirements for swimming pools, spas and hot tubs and the requirements for protective barriers and gates in these barriers. Chapter 3 establishes the responsible parties for exterminating insects and rodents, and maintaining sanitary conditions in all types of occupancies. Chapter 4 Light, Ventilation and Occupancy Limitations. The purposes of Chapter 4 are to set forth these requirements in the code and to establish the minimum environment for occupiable and habitable buildings, by establishing the minimum criteria for light and ventilation and identify- ing occupancy limitations including minimum room width and area, minimum ceiling height and restrictions to prevent overcrowding. This chapter also provides for alternative arrangements of windows and other devices to comply with the requirements for light and ventilation and prohibits certain room arrangements and occupancy uses. Chapter 5 Plumbing Facilities and Fixture Requirements. Chapter 5 establishes the mini- mum criteria for the installation, maintenance and location of plumbing systems and facilities, including the water supply system, water heating appliances, sewage disposal system and related plumbing fixtures. Sanitary and clean conditions in occupied buildings are dependent upon certain basic plumbing principles, including providing potable water to a building, providing the basic fixtures to effectively utilize that water and properly removing waste from the building. Chapter 5 establishes the mini- mum criteria to verify that these principles are maintained throughout the life of a building. Chapter 6 Mechanical and Electrical Requirements. The purpose of Chapter 6 is to establish minimum performance requirements for heating, electrical and mechanical facilities and to estab- lish minimum standards for the safety of these facilities. This chapter establishes minimum criteria for the installation and maintenance of the following: heating and air-conditioning equipment, appliances and their supporting systems; water heating equipment, appliances and systems; cooking equipment and appliances; ventilation and exhaust equipment; gas and liquid fuel distribution piping and components; fireplaces and solid fuel-burning appliances; chimneys and vents; electrical services; lighting fixtures; electrical receptacle outlets; electrical distribution system equipment, devices and wiring; and elevators, escalators and dumb- waiters. Chapter 7 Fire Safety Requirements. The purpose of Chapter 7 is to address those fire hazards that arise as the result of a building’s occupancy. It also provides minimum requirements for fire safety issues that are most likely to arise in older buildings. This chapter contains requirements for means of egress in existing buildings, including path of travel, required egress width, means of egress doors and emergency escape openings. Chapter 7 establishes the minimum requirements for fire safety facilities and fire protection sys- tems, as these are essential fire safety systems. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'(L[ Chapter 8 Referenced Standards. The code contains numerous references to standards that are used to regulate materials and methods of construction. Chapter 8 contains a comprehensive list of all standards that are referenced in the code. The standards are part of the code to the extent of the reference to the standard. Compliance with the referenced standard is necessary for compli- ance with this code. By providing specifically adopted standards, the construction and installation requirements necessary for compliance with the code can be readily determined. The basis for code compliance is, therefore, established and available on an equal basis to the code official, contractor, designer and owner. Chapter 8 is organized in a manner that makes it easy to locate specific standards. It lists all of the referenced standards, alphabetically, by acronym of the promulgating agency of the standard. Each agency’s standards are then listed in either alphabetical or numeric order based upon the stan- dard identification. The list also contains the title of the standard; the edition (date) of the standard referenced; any addenda included as part of the ICC adoption; and the section or sections of this code that reference the standard. Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 [,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'([L TABLE OF CONTENTS &+$37(5 6&23($1'$'0,1,675$7,21 3$57²6&23($1'$33/,&$7,21 6HFWLRQ *HQHUDO $SSOLFDELOLW\ 3$57²$'0,1,675$7,21$1' (1)25&(0(17 6HFWLRQ 'HSDUWPHQWRI3URSHUW\0DLQWHQDQFH ,QVSHFWLRQ 'XWLHVDQG3RZHUVRIWKH&RGH2IILFLDO $SSURYDO 9LRODWLRQV 1RWLFHVDQG2UGHUV 8QVDIH6WUXFWXUHVDQG(TXLSPHQW (PHUJHQF\0HDVXUHV 'HPROLWLRQ 0HDQVRI$SSHDO 6WRS:RUN2UGHU &+$37(5 '(),1,7,216 6HFWLRQ *HQHUDO *HQHUDO'HILQLWLRQV &+$37(5 *(1(5$/5(48,5(0(176 6HFWLRQ *HQHUDO ([WHULRU3URSHUW\$UHDV 6ZLPPLQJ3RROV6SDVDQG+RW7XEV ([WHULRU6WUXFWXUH ,QWHULRU6WUXFWXUH &RPSRQHQW6HUYLFHDELOLW\ +DQGUDLOVDQG*XDUGUDLOV 5XEELVKDQG*DUEDJH 3HVW(OLPLQDWLRQ &+$37(5 /,*+79(17,/$7,21$1' 2&&83$1&</,0,7$7,216 6HFWLRQ *HQHUDO /LJKW 9HQWLODWLRQ 2FFXSDQF\/LPLWDWLRQV &+$37(5 3/80%,1*)$&,/,7,(6$1' ),;785(5(48,5(0(176 6HFWLRQ *HQHUDO 5HTXLUHG)DFLOLWLHV 7RLOHW5RRPV 3OXPELQJ6\VWHPVDQG)L[WXUHV :DWHU6\VWHP 6DQLWDU\'UDLQDJH6\VWHP 6WRUP'UDLQDJH &+$37(5 0(&+$1,&$/$1'(/(&75,&$/ 5(48,5(0(176 6HFWLRQ *HQHUDO +HDWLQJ)DFLOLWLHV 0HFKDQLFDO(TXLSPHQW (OHFWULFDO)DFLOLWLHV (OHFWULFDO(TXLSPHQW (OHYDWRUV(VFDODWRUVDQG'XPEZDLWHUV 'XFW6\VWHPV &+$37(5 ),5(6$)(7<5(48,5(0(176 6HFWLRQ *HQHUDO 0HDQVRI(JUHVV )LUHUHVLVWDQFH5DWLQJV )LUH3URWHFWLRQ6\VWHPV &DUERQ0RQR[LGH$ODUPVDQG'HWHFWLRQ &+$37(5 5()(5(1&('67$1'$5'6 $33(1',;$ %2$5',1*67$1'$5' 6HFWLRQ $ *HQHUDO $ 0DWHULDOV $ ,QVWDOODWLRQ $ 5HIHUHQFHG6WDQGDUG ,1'(; Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 [LL ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 6&23($1'$'0,1,675$7,21 User note: About this chapter:Chapter 1 establishes the limits of applicability of the code and describes how the code is to be applied and enforced. Chapter 1 is in two parts: Part 1—Scope and Application (Sections 101 and 102) and Part 2—Administration and Enforcement (Sections 103 – 112). Section 101 identifies which buildings and structures come under its purview and references other I-Codes as applicable. This code is intended to be adopted as a legally enforceable document and it cannot be effective without adequate provisions for its adminis- tration and enforcement. The provisions of Chapter 1 establish the authority and duties of the code official appointed by the authority having jurisdiction and also establish the rights and privileges of the property owner and building occupants. 3$57²6&23($1'$33/,&$7,21 6(&7,21 *(1(5$/ >$@ 7LWOH 7KHVH UHJXODWLRQV VKDOO EH NQRZQ DV WKH ,QWHUQDWLRQDO 3URSHUW\ 0DLQWHQDQFH &RGHRI>1$0( 2) -85,6',&7,21@KHUHLQDIWHUUHIHUUHGWRDV³WKLVFRGH´ >$@6FRSH7KHSURYLVLRQVRIWKLVFRGHVKDOODSSO\WR DOOH[LVWLQJUHVLGHQWLDODQGQRQUHVLGHQWLDOVWUXFWXUHVDQGDOO H[LVWLQJSUHPLVHVDQGFRQVWLWXWHPLQLPXPUHTXLUHPHQWVDQG VWDQGDUGVIRUSUHPLVHVVWUXFWXUHVHTXLSPHQWDQGIDFLOLWLHV IRU OLJKWYHQWLODWLRQ VSDFH KHDWLQJ VDQLWDWLRQ SURWHFWLRQ IURPWKHHOHPHQWVDUHDVRQDEOHOHYHORIVDIHW\IURPILUHDQG RWKHUKD]DUGVDQGIRUDUHDVRQDEOHOHYHORIVDQLWDU\PDLQWH QDQFHWKHUHVSRQVLELOLW\RIRZQHUVDQRZQHU¶VDXWKRUL]HG DJHQWRSHUDWRUVDQGRFFXSDQWVWKHRFFXSDQF\RIH[LVWLQJ VWUXFWXUHVDQGSUHPLVHVDQGIRUDGPLQLVWUDWLRQHQIRUFHPHQW DQGSHQDOWLHV >$@,QWHQW7KLVFRGHVKDOOEHFRQVWUXHGWRVHFXUHLWV H[SUHVVHGLQWHQWZKLFKLVWRHQVXUHSXEOLFKHDOWKVDIHW\DQG ZHOIDUHLQVRIDUDVWKH\DUHDIIHFWHGE\WKHFRQWLQXHGRFFX SDQF\DQGPDLQWHQDQFHRIVWUXFWXUHVDQGSUHPLVHV([LVWLQJ VWUXFWXUHVDQGSUHPLVHVWKDWGRQRWFRPSO\ZLWKWKHVHSURYL VLRQVVKDOOEHDOWHUHGRUUHSDLUHGWRSURYLGHDPLQLPXPOHYHO RIKHDOWKDQGVDIHW\DVUHTXLUHGKHUHLQ >$@ 6HYHUDELOLW\ ,I D VHFWLRQ VXEVHFWLRQ VHQWHQFH FODXVHRUSKUDVHRIWKLVFRGHLVIRUDQ\UHDVRQKHOGWREH XQFRQVWLWXWLRQDOVXFKGHFLVLRQVKDOOQRWDIIHFWWKHYDOLGLW\RI WKHUHPDLQLQJSRUWLRQVRIWKLVFRGH 6(&7,21 $33/,&$%,/,7< >$@*HQHUDO:KHUHWKHUHLVDFRQIOLFWEHWZHHQDJHQ HUDO UHTXLUHPHQW DQG D VSHFLILF UHTXLUHPHQW WKH VSHFLILF UHTXLUHPHQWVKDOOJRYHUQ:KHUHGLIIHUHQFHVRFFXUEHWZHHQ SURYLVLRQVRIWKLVFRGHDQGWKHUHIHUHQFHGVWDQGDUGVWKHSUR YLVLRQVRIWKLVFRGHVKDOODSSO\:KHUHLQDVSHFLILFFDVHGLI IHUHQWVHFWLRQVRIWKLVFRGHVSHFLI\GLIIHUHQWUHTXLUHPHQWVWKH PRVWUHVWULFWLYHVKDOOJRYHUQ 0DLQWHQDQFH(TXLSPHQWV\VWHPVGHYLFHVDQGVDIH JXDUGVUHTXLUHGE\WKLVFRGHRUDSUHYLRXVUHJXODWLRQRUFRGH XQGHUZKLFKWKHVWUXFWXUHRUSUHPLVHVZDVFRQVWUXFWHG DOWHUHGRUUHSDLUHGVKDOOEHPDLQWDLQHGLQJRRGZRUNLQJRUGHU $QRZQHURZQHU¶VDXWKRUL]HGDJHQWRSHUDWRURURFFXSDQW VKDOOQRWFDXVHDQ\VHUYLFHIDFLOLW\HTXLSPHQWRUXWLOLW\WKDW LVUHTXLUHGXQGHUWKLVVHFWLRQWREHUHPRYHGIURPVKXWRII IURPRUGLVFRQWLQXHGIRUDQ\RFFXSLHGGZHOOLQJH[FHSWIRU VXFK WHPSRUDU\ LQWHUUXSWLRQ DV QHFHVVDU\ ZKLOH UHSDLUV RU DOWHUDWLRQVDUHLQSURJUHVV7KHUHTXLUHPHQWVRIWKLVFRGHDUH QRWLQWHQGHGWRSURYLGHWKHEDVLVIRUUHPRYDORUDEURJDWLRQRI ILUH SURWHFWLRQ DQG VDIHW\ V\VWHPV DQG GHYLFHV LQ H[LVWLQJ VWUXFWXUHV([FHSWDVRWKHUZLVHVSHFLILHGKHUHLQWKHRZQHURU WKHRZQHU¶V DXWKRUL]HG DJHQW VKDOO EH UHVSRQVLEOH IRU WKH PDLQWHQDQFHRIEXLOGLQJVVWUXFWXUHVDQGSUHPLVHV >$@$SSOLFDWLRQRIRWKHUFRGHV5HSDLUVDGGLWLRQVRU DOWHUDWLRQVWRDVWUXFWXUHRUFKDQJHVRIRFFXSDQF\VKDOOEH GRQHLQDFFRUGDQFHZLWKWKHSURFHGXUHVDQGSURYLVLRQVRIWKH ,QWHUQDWLRQDO%XLOGLQJ&RGH,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ &RGH ,QWHUQDWLRQDO (QHUJ\ &RQVHUYDWLRQ &RGH ,QWHUQD WLRQDO)LUH&RGH,QWHUQDWLRQDO)XHO*DV&RGH,QWHUQDWLRQDO 0HFKDQLFDO&RGH,QWHUQDWLRQDO5HVLGHQWLDO&RGH,QWHUQD WLRQDO3OXPELQJ&RGHDQG1)3$1RWKLQJLQWKLVFRGH VKDOOEHFRQVWUXHGWRFDQFHOPRGLI\RUVHWDVLGHDQ\SURYL VLRQRIWKH,QWHUQDWLRQDO=RQLQJ&RGH >$@([LVWLQJUHPHGLHV7KHSURYLVLRQVLQWKLVFRGH VKDOOQRWEHFRQVWUXHGWRDEROLVKRULPSDLUH[LVWLQJUHPHGLHV RIWKHMXULVGLFWLRQRULWVRIILFHUVRUDJHQFLHVUHODWLQJWRWKH UHPRYDO RU GHPROLWLRQ RI DQ\ VWUXFWXUH WKDW LV GDQJHURXV XQVDIHDQGLQVDQLWDU\ >$@:RUNPDQVKLS5HSDLUVPDLQWHQDQFHZRUNDOWHU DWLRQVRULQVWDOODWLRQVWKDWDUHFDXVHGGLUHFWO\RULQGLUHFWO\E\ WKHHQIRUFHPHQWRIWKLVFRGHVKDOOEHH[HFXWHGDQGLQVWDOOHG LQDZRUNPDQOLNHPDQQHUDQGLQVWDOOHGLQDFFRUGDQFHZLWKWKH PDQXIDFWXUHU¶VLQVWUXFWLRQV >$@+LVWRULFEXLOGLQJV7KHSURYLVLRQVRIWKLVFRGH VKDOOQRWEHPDQGDWRU\IRUH[LVWLQJEXLOGLQJVRUVWUXFWXUHV GHVLJQDWHG DV KLVWRULF EXLOGLQJV ZKHUH VXFK EXLOGLQJV RU VWUXFWXUHVDUHMXGJHGE\WKHFRGHRIILFLDOWREHVDIHDQGLQWKH SXEOLFLQWHUHVWRIKHDOWKVDIHW\DQGZHOIDUH >$@5HIHUHQFHGFRGHVDQGVWDQGDUGV7KHFRGHVDQG VWDQGDUGVUHIHUHQFHGLQWKLVFRGHVKDOOEHWKRVHWKDWDUHOLVWHG LQ&KDSWHUDQGFRQVLGHUHGSDUWRIWKHUHTXLUHPHQWVRIWKLV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 >$@ 7LWOH 7KHVH UHJXODWLRQV VKDOO EH NQRZQ DV WKH ,QWHUQDWLRQDO 3URSHUW\ 0DLQWHQDQFH &RGH RI >1$0( 2) -85,6',&7,21@ KHUHLQDIWHU UHIHUUHG WR DV WKLV FRGH >$@ 5HIHUHQFHG FRGHV DQG VWDQGDUGV 7KH FRGHV DQG VWDQGDUGV UHIHUHQFHG LQ WKLV FRGH VKDOO EH WKRVH WKDW DUH OLVWHG LQ &KDSWHU DQG FRQVLGHUHG SDUW RI WKH UHTXLUHPHQWV RI WKLVW 1 2 3 Summary of Comments on 2018_IPMC-1st ptg.book Page: 14 Number: 1 Author: MPoehlman Subject: Replace Date: 7/18/2019 2:49:34 PM -05'00' [A] 101.1 Title. These regulations shall be known as the Property Maintenance Code of the City of Richfield, hereinafter referred to as "this code." Number: 2 Author: MPoehlman Subject: Inserted Text Date: 1/16/2020 2:49:31 PM 102.3 Application of other codes. Repairs, additions or alterations to a structure, or changes of occupancy, shall be done in accordance with the procedures and provisions of the Minnesota State Building Code (MSBC), established pursuant to M.S. §§ 326B.101 to 326B.194, as adopted by the city. Nothing in this code shall be construed to cancel, modify or set aside any provision of the City of Richfield ZoningCode. Number: 3 Author: MPoehlman Subject: Replace Date: 1/16/2020 3:01:19 PM 102.7 Referenced codes and standards. The codes and standards referenced in Chapter 8 and considered part of the requirements of this code to the prescribed extent of each such reference. Where differences occur between provisions of this code and the MSBC, the MSBC shall apply. 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( FRGHWRWKHSUHVFULEHGH[WHQWRIHDFKVXFKUHIHUHQFHDQGDV IXUWKHUUHJXODWHGLQ6HFWLRQVDQG ([FHSWLRQ:KHUHHQIRUFHPHQWRIDFRGHSURYLVLRQZRXOG YLRODWHWKHFRQGLWLRQVRIWKHOLVWLQJRIWKHHTXLSPHQWRU DSSOLDQFHWKHFRQGLWLRQVRIWKHOLVWLQJVKDOODSSO\ >$@&RQIOLFWV:KHUHFRQIOLFWVRFFXUEHWZHHQSUR YLVLRQVRIWKLVFRGHDQGWKHUHIHUHQFHGVWDQGDUGVWKHSUR YLVLRQVRIWKLVFRGHVKDOODSSO\ >$@3URYLVLRQVLQ UHIHUHQFHGFRGHVDQG VWDQ GDUGV:KHUHWKHH[WHQWRIWKHUHIHUHQFHWRDUHIHUHQFHG FRGHRUVWDQGDUGLQFOXGHVVXEMHFWPDWWHUWKDWLVZLWKLQWKH VFRSHRIWKLVFRGHWKHSURYLVLRQVRIWKLVFRGHDVDSSOLFD EOHVKDOOWDNHSUHFHGHQFHRYHUWKHSURYLVLRQVLQWKHUHIHU HQFHGFRGHRUVWDQGDUG >$@ 5HTXLUHPHQWV QRW FRYHUHG E\ FRGH 5HTXLUH PHQWVQHFHVVDU\IRUWKHVWUHQJWKVWDELOLW\RUSURSHURSHUDWLRQ RIDQH[LVWLQJIL[WXUHVWUXFWXUHRUHTXLSPHQWRUIRUWKHSXE OLFVDIHW\KHDOWKDQGJHQHUDOZHOIDUHQRWVSHFLILFDOO\FRYHUHG E\WKLVFRGHVKDOOEHGHWHUPLQHGE\WKHFRGHRIILFLDO >$@$SSOLFDWLRQRIUHIHUHQFHV5HIHUHQFHVWRFKDSWHU RUVHFWLRQQXPEHUVRUWRSURYLVLRQVQRWVSHFLILFDOO\LGHQWL ILHGE\QXPEHUVKDOOEHFRQVWUXHGWRUHIHUWRVXFKFKDSWHU VHFWLRQRUSURYLVLRQRIWKLVFRGH >$@2WKHUODZV7KHSURYLVLRQVRIWKLVFRGHVKDOOQRW EHGHHPHGWRQXOOLI\DQ\SURYLVLRQVRIORFDOVWDWHRUIHGHUDO ODZ 3$57²$'0,1,675$7,21$1'(1)25&(0(17 6(&7,21 '(3$570(172)3523(57< 0$,17(1$1&(,163(&7,21 >$@*HQHUDO7KHGHSDUWPHQWRISURSHUW\PDLQWHQDQFH LQVSHFWLRQ LV KHUHE\ FUHDWHG DQG WKH H[HFXWLYH RIILFLDO LQ FKDUJHWKHUHRIVKDOOEHNQRZQDVWKHFRGHRIILFLDO >$@$SSRLQWPHQW7KHFRGHRIILFLDOVKDOOEHDSSRLQWHG E\WKHFKLHIDSSRLQWLQJDXWKRULW\RIWKHMXULVGLFWLRQ >$@'HSXWLHV,QDFFRUGDQFHZLWKWKHSUHVFULEHGSURFH GXUHV RI WKLV MXULVGLFWLRQ DQG ZLWK WKH FRQFXUUHQFH RI WKH DSSRLQWLQJDXWKRULW\WKHFRGHRIILFLDOVKDOOKDYHWKHDXWKRULW\ WRDSSRLQWDGHSXW\V6XFKHPSOR\HHVVKDOOKDYHSRZHUVDV GHOHJDWHGE\WKHFRGHRIILFLDO >$@/LDELOLW\7KHFRGHRIILFLDOPHPEHURIWKHERDUG RIDSSHDOVRUHPSOR\HHFKDUJHGZLWKWKHHQIRUFHPHQWRIWKLV FRGHZKLOHDFWLQJIRUWKHMXULVGLFWLRQLQJRRGIDLWKDQGZLWK RXWPDOLFHLQWKHGLVFKDUJHRIWKHGXWLHVUHTXLUHGE\WKLVFRGH RURWKHUSHUWLQHQWODZRURUGLQDQFHVKDOOQRWWKHUHE\EHUHQ GHUHGFLYLOO\RUFULPLQDOO\OLDEOHSHUVRQDOO\DQGLVKHUHE\ UHOLHYHGIURPDOOSHUVRQDOOLDELOLW\IRUDQ\GDPDJHDFFUXLQJ WRSHUVRQVRUSURSHUW\DVDUHVXOWRIDQDFWRUE\UHDVRQRIDQ DFWRURPLVVLRQLQWKHGLVFKDUJHRIRIILFLDOGXWLHV >$@/HJDOGHIHQVH$Q\VXLWRUFULPLQDOFRPSODLQW LQVWLWXWHGDJDLQVWDQ\RIILFHURUHPSOR\HHEHFDXVHRIDQ DFWSHUIRUPHGE\WKDWRIILFHURUHPSOR\HHLQWKHODZIXO GLVFKDUJHRIGXWLHVDQGXQGHUWKHSURYLVLRQVRIWKLVFRGH VKDOOEHGHIHQGHGE\WKHOHJDOUHSUHVHQWDWLYHRIWKHMXULV GLFWLRQXQWLOWKHILQDOWHUPLQDWLRQRIWKHSURFHHGLQJV7KH FRGH RIILFLDO RU DQ\ VXERUGLQDWH VKDOO QRW EH OLDEOH IRU FRVWVLQDQDFWLRQVXLWRUSURFHHGLQJWKDWLVLQVWLWXWHGLQ SXUVXDQFHRIWKHSURYLVLRQVRIWKLVFRGH >$@)HHV7KHIHHVIRUDFWLYLWLHVDQGVHUYLFHVSHUIRUPHG E\WKHGHSDUWPHQWLQFDUU\LQJRXWLWVUHVSRQVLELOLWLHVXQGHU WKLVFRGHVKDOOEHDVLQGLFDWHGLQWKHIROORZLQJVFKHGXOH >-85,6',&7,2172,16(57$335235,$7(6&+('8/(@ 6(&7,21 '87,(6$1'32:(562)7+(&2'(2)),&,$/ >$@*HQHUDO7KHFRGHRIILFLDOLVKHUHE\DXWKRUL]HG DQGGLUHFWHGWRHQIRUFHWKHSURYLVLRQVRIWKLVFRGH7KHFRGH RIILFLDOVKDOOKDYHWKHDXWKRULW\WRUHQGHULQWHUSUHWDWLRQVRI WKLVFRGHDQGWRDGRSWSROLFLHVDQGSURFHGXUHVLQRUGHUWR FODULI\WKHDSSOLFDWLRQRILWVSURYLVLRQV6XFKLQWHUSUHWDWLRQV SROLFLHVDQGSURFHGXUHVVKDOOEHLQFRPSOLDQFHZLWKWKHLQWHQW DQGSXUSRVHRIWKLVFRGH6XFKSROLFLHVDQGSURFHGXUHVVKDOO QRWKDYHWKHHIIHFWRIZDLYLQJUHTXLUHPHQWVVSHFLILFDOO\SUR YLGHGIRULQWKLVFRGH >$@,QVSHFWLRQV7KHFRGHRIILFLDOVKDOOPDNHDOORIWKH UHTXLUHGLQVSHFWLRQVRUVKDOODFFHSWUHSRUWVRILQVSHFWLRQE\ DSSURYHGDJHQFLHVRULQGLYLGXDOV5HSRUWVRIVXFKLQVSHFWLRQV VKDOOEHLQZULWLQJDQGEHFHUWLILHGE\DUHVSRQVLEOHRIILFHURI VXFKDSSURYHGDJHQF\RUE\WKHUHVSRQVLEOHLQGLYLGXDO7KH FRGHRIILFLDOLVDXWKRUL]HGWRHQJDJHVXFKH[SHUWRSLQLRQDV GHHPHGQHFHVVDU\WRUHSRUWRQXQXVXDOWHFKQLFDOLVVXHVWKDW DULVHVXEMHFWWRWKHDSSURYDORIWKHDSSRLQWLQJDXWKRULW\ >$@5LJKWRIHQWU\:KHUHLWLVQHFHVVDU\WRPDNHDQ LQVSHFWLRQWRHQIRUFHWKHSURYLVLRQVRIWKLVFRGHRUZKHQHYHU WKHFRGHRIILFLDOKDVUHDVRQDEOHFDXVHWREHOLHYHWKDWWKHUH H[LVWVLQDVWUXFWXUHRUXSRQDSUHPLVHVDFRQGLWLRQLQYLROD WLRQRIWKLVFRGHWKHFRGHRIILFLDOLVDXWKRUL]HGWRHQWHUWKH VWUXFWXUHRUSUHPLVHVDWUHDVRQDEOHWLPHVWRLQVSHFWRUSHU IRUPWKHGXWLHVLPSRVHGE\WKLVFRGHSURYLGHGWKDWLIVXFK VWUXFWXUHRUSUHPLVHVLVRFFXSLHGWKHFRGHRIILFLDOVKDOOSUHV HQW FUHGHQWLDOV WR WKHRFFXSDQW DQG UHTXHVW HQWU\ ,I VXFK VWUXFWXUHRUSUHPLVHVLVXQRFFXSLHGWKHFRGHRIILFLDOVKDOO ILUVWPDNHDUHDVRQDEOHHIIRUWWRORFDWHWKHRZQHURZQHU¶V DXWKRUL]HGDJHQWRURWKHUSHUVRQKDYLQJFKDUJHRUFRQWURORI WKHVWUXFWXUHRUSUHPLVHVDQGUHTXHVWHQWU\,IHQWU\LV UHIXVHGWKHFRGHRIILFLDOVKDOOKDYHUHFRXUVHWRWKHUHPHGLHV SURYLGHGE\ODZWRVHFXUHHQWU\ >$@,GHQWLILFDWLRQ7KHFRGHRIILFLDOVKDOOFDUU\SURSHU LGHQWLILFDWLRQZKHQLQVSHFWLQJVWUXFWXUHVRUSUHPLVHVLQWKH SHUIRUPDQFHRIGXWLHVXQGHUWKLVFRGH >$@1RWLFHVDQGRUGHUV7KHFRGHRIILFLDOVKDOOLVVXH DOOQHFHVVDU\QRWLFHVRURUGHUVWRHQVXUHFRPSOLDQFHZLWKWKLV FRGH >$@'HSDUWPHQWUHFRUGV7KHFRGHRIILFLDOVKDOONHHS RIILFLDOUHFRUGVRIDOOEXVLQHVVDQGDFWLYLWLHVRIWKHGHSDUW PHQWVSHFLILHGLQWKHSURYLVLRQVRIWKLVFRGH6XFKUHFRUGV VKDOOEHUHWDLQHGLQWKHRIILFLDOUHFRUGVIRUWKHSHULRGUHTXLUHG IRUUHWHQWLRQRISXEOLFUHFRUGV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 FRGH WR WKH SUHVFULEHG H[WHQW RI HDFK VXFK UHIHUHQFH DQG DV IXUWKHU UHJXODWHG LQ 6HFWLRQV DQG ([FHSWLRQ:KHUH HQIRUFHPHQW RI D FRGH SURYLVLRQ ZRXOG YLRODWH WKH FRQGLWLRQV RI WKH OLVWLQJ RI WKH HTXLSPHQW RU DSSOLDQFH WKH FRQGLWLRQV RI WKH OLVWLQJ VKDOO DSSO\ >$@ &RQIOLFWV :KHUH FRQIOLFWV RFFXU EHWZHHQ SUR YLVLRQV RI WKLV FRGH DQG WKH UHIHUHQFHG VWDQGDUGV WKH SUR YLVLRQV RI WKLV FRGH VKDOO DSSO\ >$@ 3URYLVLRQV LQ UHIHUHQFHG FRGHV DQG VWDQ GDUGV :KHUH WKH H[WHQW RI WKH UHIHUHQFH WR D UHIHUHQFHG FRGH RU VWDQGDUG LQFOXGHV VXEMHFW PDWWHU WKDW LV ZLWKLQ WKH VFRSH RI WKLV FRGH WKH SURYLVLRQV RI WKLV FRGH DV DSSOLFD EOH VKDOO WDNH SUHFHGHQFH RYHU WKH SURYLVLRQV LQ WKH UHIHU HQFHG FRGH RU VWDQGDUG >$@*HQHUDO 7KH GHSDUWPHQW RI SURSHUW\ PDLQWHQDQFH LQVSHFWLRQ LV KHUHE\ FUHDWHG DQG WKH H[HFXWLYH RIILFLDO LQ FKDUJH WKHUHRI VKDOO EH NQRZQ DV WKH FRGH RIILFLDO >-85,6',&7,21 72 ,16(57 $335235,$7( 6&+('8/( @ 1 2 3 Page: 15 Number: 1 Author: MPoehlman Subject: Replace Date: 7/18/2019 3:08:14 PM -05'00' Appendix D of the City Code. Number: 2 Author: MPoehlman Subject: Replace Date: 1/14/2020 11:38:38 AM Number: 3 Author: MPoehlman Subject: Replace Date: 7/18/2019 3:03:05 PM -05'00' 103.1 General. The City Manager or his or her designee is responsible for administering the provisions of this code. Collectively, these designees shall be known as the Code Official. 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 6(&7,21 $33529$/ >$@ 0RGLILFDWLRQV:KHQHYHUWKHUHDUHSUDFWLFDOGLIIL FXOWLHVLQYROYHGLQFDUU\LQJRXWWKHSURYLVLRQVRIWKLVFRGH WKHFRGHRIILFLDOVKDOOKDYHWKHDXWKRULW\WRJUDQWPRGLILFD WLRQVIRULQGLYLGXDOFDVHVXSRQDSSOLFDWLRQRIWKHRZQHURU RZQHU¶VDXWKRUL]HGDJHQWSURYLGHGWKDWWKHFRGHRIILFLDOVKDOO ILUVWILQGWKDWVSHFLDOLQGLYLGXDOUHDVRQPDNHVWKHVWULFWOHWWHU RIWKLVFRGHLPSUDFWLFDOWKHPRGLILFDWLRQLVLQFRPSOLDQFH ZLWKWKHLQWHQWDQGSXUSRVHRIWKLVFRGHDQGWKDWVXFKPRGLIL FDWLRQ GRHV QRW OHVVHQ KHDOWK OLIH DQG ILUH VDIHW\ UHTXLUH PHQWV7KHGHWDLOVRIDFWLRQJUDQWLQJPRGLILFDWLRQVVKDOOEH UHFRUGHGDQGHQWHUHGLQWKHGHSDUWPHQWILOHV >$@ $OWHUQDWLYHPDWHULDOVGHVLJQDQGPHWKRGVRI FRQVWUXFWLRQDQGHTXLSPHQW7KHSURYLVLRQVRIWKLVFRGH DUHQRWLQWHQGHGWRSUHYHQWWKHLQVWDOODWLRQRIDQ\PDWHULDORU WRSURKLELWDQ\GHVLJQRUPHWKRGRIFRQVWUXFWLRQQRWVSHFLIL FDOO\SUHVFULEHGE\WKLVFRGHSURYLGHGWKDWDQ\VXFKDOWHUQD WLYHKDVEHHQDSSURYHG$QDOWHUQDWLYHPDWHULDOGHVLJQRU PHWKRG RI FRQVWUXFWLRQ VKDOO EHDSSURYHG ZKHUH WKHFRGH RIILFLDO ILQGV WKDW WKH SURSRVHG GHVLJQ LV VDWLVIDFWRU\ DQG FRPSOLHVZLWKWKHLQWHQWRIWKHSURYLVLRQVRIWKLVFRGHDQG WKDWWKHPDWHULDOPHWKRGRUZRUNRIIHUHGLVIRUWKHSXUSRVH LQWHQGHGQRWOHVVWKDQWKHHTXLYDOHQWRIWKDWSUHVFULEHGLQWKLV FRGHLQTXDOLW\VWUHQJWKHIIHFWLYHQHVVILUHUHVLVWDQFHGXUD ELOLW\DQGVDIHW\:KHUHWKHDOWHUQDWLYHPDWHULDOGHVLJQRU PHWKRGRIFRQVWUXFWLRQLVQRWDSSURYHGWKHFRGHRIILFLDOVKDOO UHVSRQGLQZULWLQJVWDWLQJWKHUHDVRQVZK\WKHDOWHUQDWLYH ZDVQRWDSSURYHG >$@ 5HTXLUHGWHVWLQJ:KHQHYHUWKHUHLVLQVXIILFLHQW HYLGHQFHRIFRPSOLDQFHZLWKWKHSURYLVLRQVRIWKLVFRGHRU HYLGHQFHWKDWDPDWHULDORUPHWKRGGRHVQRWFRQIRUPWRWKH UHTXLUHPHQWVRIWKLVFRGHRULQRUGHUWRVXEVWDQWLDWHFODLPV IRUDOWHUQDWLYHPDWHULDOVRUPHWKRGVWKHFRGHRIILFLDOVKDOO KDYHWKHDXWKRULW\WRUHTXLUHWHVWVWREHPDGHDVHYLGHQFHRI FRPSOLDQFHZLWKRXWH[SHQVHWRWKHMXULVGLFWLRQ >$@ 7HVWPHWKRGV7HVWPHWKRGVVKDOOEHDVVSHFL ILHGLQWKLVFRGHRUE\RWKHUUHFRJQL]HGWHVWVWDQGDUGV,Q WKHDEVHQFHRIUHFRJQL]HGDQGDFFHSWHGWHVWPHWKRGVWKH FRGH RIILFLDO VKDOO EH SHUPLWWHG WR DSSURYH DSSURSULDWH WHVWLQJSURFHGXUHVSHUIRUPHGE\DQDSSURYHGDJHQF\ >$@ 7HVWUHSRUWV5HSRUWVRIWHVWVVKDOOEHUHWDLQHG E\WKHFRGHRIILFLDOIRUWKHSHULRGUHTXLUHGIRUUHWHQWLRQRI SXEOLFUHFRUGV >$@ 8VHGPDWHULDODQGHTXLSPHQW0DWHULDOVWKDWDUH UHXVHGVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRIWKLVFRGHIRU QHZPDWHULDOV0DWHULDOVHTXLSPHQWDQGGHYLFHVVKDOOQRWEH UHXVHGXQOHVVVXFKHOHPHQWVDUHLQJRRGUHSDLURUKDYHEHHQ UHFRQGLWLRQHGDQGWHVWHGZKHUHQHFHVVDU\SODFHGLQJRRGDQG SURSHUZRUNLQJFRQGLWLRQDQGDSSURYHGE\WKHFRGHRIILFLDO >$@ $SSURYHGPDWHULDOVDQGHTXLSPHQW0DWHULDOV HTXLSPHQWDQGGHYLFHVDSSURYHGE\WKHFRGHRIILFLDOVKDOOEH FRQVWUXFWHGDQGLQVWDOOHGLQDFFRUGDQFHZLWKVXFKDSSURYDO >$@ 5HVHDUFKUHSRUWV6XSSRUWLQJGDWDZKHUHQHFHV VDU\WRDVVLVWLQWKHDSSURYDORIPDWHULDOVRUDVVHPEOLHVQRW VSHFLILFDOO\SURYLGHGIRULQWKLVFRGHVKDOOFRQVLVWRIYDOLG UHVHDUFKUHSRUWVIURPDSSURYHGVRXUFHV 6(&7,21 9,2/$7,216 >$@ 8QODZIXODFWV,WVKDOOEHXQODZIXOIRUDSHUVRQ ILUPRUFRUSRUDWLRQWREHLQFRQIOLFWZLWKRULQYLRODWLRQRI DQ\RIWKHSURYLVLRQVRIWKLVFRGH >$@ 1RWLFHRIYLRODWLRQ7KHFRGHRIILFLDOVKDOOVHUYHD QRWLFHRIYLRODWLRQRURUGHULQDFFRUGDQFHZLWK6HFWLRQ >$@ 3URVHFXWLRQRIYLRODWLRQ$Q\SHUVRQIDLOLQJWR FRPSO\ZLWKDQRWLFHRIYLRODWLRQRURUGHUVHUYHGLQDFFRU GDQFHZLWK6HFWLRQVKDOOEHGHHPHGJXLOW\RIDPLVGH PHDQRU RU FLYLO LQIUDFWLRQ DV GHWHUPLQHG E\ WKH ORFDO PXQLFLSDOLW\DQGWKHYLRODWLRQVKDOOEHGHHPHGDVWULFWOLDELO LW\RIIHQVH,IWKHQRWLFHRIYLRODWLRQLVQRWFRPSOLHGZLWKWKH FRGHRIILFLDOVKDOOLQVWLWXWHWKHDSSURSULDWHSURFHHGLQJDWODZ RULQHTXLW\WRUHVWUDLQFRUUHFWRUDEDWHVXFKYLRODWLRQRUWR UHTXLUHWKHUHPRYDORUWHUPLQDWLRQRIWKHXQODZIXORFFXSDQF\ RIWKHVWUXFWXUHLQYLRODWLRQRIWKHSURYLVLRQVRIWKLVFRGHRU RIWKHRUGHURUGLUHFWLRQPDGHSXUVXDQWWKHUHWR$Q\DFWLRQ WDNHQE\WKHDXWKRULW\KDYLQJMXULVGLFWLRQRQVXFKSUHPLVHV VKDOOEHFKDUJHGDJDLQVWWKHUHDOHVWDWHXSRQZKLFKWKHVWUXF WXUHLVORFDWHGDQGVKDOOEHDOLHQXSRQVXFKUHDOHVWDWH >$@ 9LRODWLRQSHQDOWLHV$Q\SHUVRQZKRVKDOOYLRODWH DSURYLVLRQRIWKLVFRGHRUIDLOWRFRPSO\WKHUHZLWKRUZLWK DQ\RIWKHUHTXLUHPHQWVWKHUHRIVKDOOEHSURVHFXWHGZLWKLQ WKHOLPLWVSURYLGHGE\VWDWHRUORFDOODZV(DFKGD\WKDWDYLR ODWLRQ FRQWLQXHV DIWHU GXH QRWLFH KDV EHHQ VHUYHG VKDOO EH GHHPHGDVHSDUDWHRIIHQVH >$@ $EDWHPHQWRIYLRODWLRQ7KHLPSRVLWLRQRIWKH SHQDOWLHVKHUHLQSUHVFULEHGVKDOOQRWSUHFOXGHWKHOHJDORIILFHU RI WKH MXULVGLFWLRQ IURP LQVWLWXWLQJ DSSURSULDWH DFWLRQ WR UHVWUDLQ FRUUHFW RU DEDWH D YLRODWLRQ RU WR SUHYHQW LOOHJDO RFFXSDQF\RIDEXLOGLQJVWUXFWXUHRUSUHPLVHVRUWRVWRSDQ LOOHJDODFWFRQGXFWEXVLQHVVRUXWLOL]DWLRQRIWKHEXLOGLQJ VWUXFWXUHRUSUHPLVHV 6(&7,21 127,&(6$1'25'(56 1RWLFHWRSHUVRQUHVSRQVLEOH:KHQHYHUWKHFRGHRIIL FLDOGHWHUPLQHVWKDWWKHUHKDVEHHQDYLRODWLRQRIWKLVFRGHRU KDVJURXQGVWREHOLHYHWKDWDYLRODWLRQKDVRFFXUUHGQRWLFH VKDOOEHJLYHQLQWKHPDQQHUSUHVFULEHGLQ6HFWLRQVDQG WRWKHSHUVRQUHVSRQVLEOHIRUWKHYLRODWLRQDVVSHFLILHG LQWKLVFRGH1RWLFHVIRUFRQGHPQDWLRQSURFHGXUHVVKDOOFRP SO\ZLWK6HFWLRQ )RUP6XFKQRWLFHSUHVFULEHGLQ6HFWLRQVKDOOEH LQDFFRUGDQFHZLWKDOORIWKHIROORZLQJ %HLQZULWLQJ ,QFOXGHDGHVFULSWLRQRIWKHUHDOHVWDWHVXIILFLHQWIRU LGHQWLILFDWLRQ ,QFOXGHDVWDWHPHQWRIWKHYLRODWLRQRUYLRODWLRQVDQG ZK\WKHQRWLFHLVEHLQJLVVXHG ,QFOXGHDFRUUHFWLRQRUGHUDOORZLQJDUHDVRQDEOHWLPHWR PDNHWKHUHSDLUVDQGLPSURYHPHQWVUHTXLUHGWREULQJ WKHGZHOOLQJXQLWRUVWUXFWXUHLQWRFRPSOLDQFHZLWKWKH SURYLVLRQVRIWKLVFRGH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 G VKDOO EH 1 2 3 Page: 16 Number: 1 Author: MPoehlman Subject: Replace Date: 12/23/2019 11:54:21 AM ...may be... Number: 2 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 1:55:10 PM Number: 3 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 1:55:14 PM 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( ,QIRUPWKHSURSHUW\RZQHURURZQHU¶VDXWKRUL]HGDJHQW RIWKHULJKWWRDSSHDO ,QFOXGHDVWDWHPHQWRIWKHULJKWWRILOHDOLHQLQDFFRU GDQFHZLWK6HFWLRQ 0HWKRGRIVHUYLFH6XFKQRWLFHVKDOOEHGHHPHGWREH SURSHUO\VHUYHGLIDFRS\WKHUHRILVGHOLYHUHGSHUVRQDOO\RU VHQW E\ FHUWLILHG RU ILUVWFODVV PDLO DGGUHVVHG WR WKH ODVW NQRZQDGGUHVV,IWKHQRWLFHLVUHWXUQHGVKRZLQJWKDWWKHOHW WHUZDVQRWGHOLYHUHGDFRS\WKHUHRIVKDOOEHSRVWHGLQDFRQ VSLFXRXV SODFH LQ RU DERXW WKH VWUXFWXUH DIIHFWHG E\ VXFK QRWLFH 8QDXWKRUL]HGWDPSHULQJ6LJQVWDJVRUVHDOVSRVWHG RU DIIL[HG E\ WKHFRGH RIILFLDO VKDOO QRW EH PXWLODWHG GHVWUR\HGRUWDPSHUHGZLWKRUUHPRYHGZLWKRXWDXWKRUL]D WLRQIURPWKHFRGHRIILFLDO 3HQDOWLHV3HQDOWLHVIRUQRQFRPSOLDQFHZLWKRUGHUVDQG QRWLFHVVKDOOEHDVVHWIRUWKLQ6HFWLRQ 7UDQVIHURIRZQHUVKLS,WVKDOOEHXQODZIXOIRUWKH RZQHURIDQ\GZHOOLQJXQLWRUVWUXFWXUHZKRKDVUHFHLYHGD FRPSOLDQFHRUGHURUXSRQZKRPDQRWLFHRIYLRODWLRQKDV EHHQVHUYHGWRVHOOWUDQVIHUPRUWJDJHOHDVHRURWKHUZLVHGLV SRVHRIVXFKGZHOOLQJXQLWRUVWUXFWXUHWRDQRWKHUXQWLOWKH SURYLVLRQVRIWKHFRPSOLDQFHRUGHURUQRWLFHRIYLRODWLRQKDYH EHHQ FRPSOLHG ZLWK RU XQWLO VXFKRZQHU RU WKH RZQHU¶V DXWKRUL]HG DJHQW VKDOO ILUVW IXUQLVK WKH JUDQWHH WUDQVIHUHH PRUWJDJHHRUOHVVHHDWUXHFRS\RIDQ\FRPSOLDQFHRUGHURU QRWLFHRIYLRODWLRQLVVXHGE\WKHFRGHRIILFLDODQGVKDOOIXU QLVK WR WKHFRGH RIILFLDO D VLJQHG DQG QRWDUL]HG VWDWHPHQW IURPWKHJUDQWHHWUDQVIHUHHPRUWJDJHHRUOHVVHHDFNQRZO HGJLQJWKHUHFHLSWRIVXFKFRPSOLDQFHRUGHURUQRWLFHRIYLR ODWLRQDQGIXOO\DFFHSWLQJWKHUHVSRQVLELOLW\ZLWKRXWFRQGLWLRQ IRUPDNLQJWKHFRUUHFWLRQVRUUHSDLUVUHTXLUHGE\VXFKFRP SOLDQFHRUGHURUQRWLFHRIYLRODWLRQ 6(&7,21 816$)(6758&785(6$1'(48,30(17 *HQHUDO:KHQDVWUXFWXUHRUHTXLSPHQWLVIRXQGE\ WKHFRGHRIILFLDOWREHXQVDIHRUZKHQDVWUXFWXUHLVIRXQG XQILWIRUKXPDQRFFXSDQF\RULVIRXQGXQODZIXOVXFKVWUXF WXUHVKDOOEHFRQGHPQHGSXUVXDQWWRWKHSURYLVLRQVRIWKLV FRGH 8QVDIHVWUXFWXUHV$QXQVDIHVWUXFWXUHLVRQHWKDW LVIRXQGWREHGDQJHURXVWRWKHOLIHKHDOWKSURSHUW\RU VDIHW\RIWKHSXEOLFRUWKHRFFXSDQWVRIWKHVWUXFWXUHE\QRW SURYLGLQJPLQLPXPVDIHJXDUGVWRSURWHFWRUZDUQRFFX SDQWVLQWKHHYHQWRIILUHRUEHFDXVHVXFKVWUXFWXUHFRQ WDLQV XQVDIH HTXLSPHQW RU LV VR GDPDJHG GHFD\HG GLODSLGDWHGVWUXFWXUDOO\XQVDIHRURIVXFKIDXOW\FRQVWUXF WLRQRUXQVWDEOHIRXQGDWLRQWKDWSDUWLDORUFRPSOHWHFRO ODSVHLVSRVVLEOH 8QVDIH HTXLSPHQW8QVDIH HTXLSPHQW LQFOXGHV DQ\ERLOHUKHDWLQJHTXLSPHQWHOHYDWRUPRYLQJVWDLUZD\ HOHFWULFDOZLULQJRUGHYLFHIODPPDEOHOLTXLGFRQWDLQHUVRU RWKHUHTXLSPHQWRQWKHSUHPLVHVRUZLWKLQWKHVWUXFWXUH WKDWLVLQVXFKGLVUHSDLURUFRQGLWLRQWKDWVXFKHTXLSPHQWLV DKD]DUGWROLIHKHDOWKSURSHUW\RUVDIHW\RIWKHSXEOLFRU RFFXSDQWVRIWKHSUHPLVHVRUVWUXFWXUH 6WUXFWXUHXQILWIRUKXPDQRFFXSDQF\$VWUXF WXUHLVXQILWIRUKXPDQRFFXSDQF\ZKHQHYHUWKHFRGHRIIL FLDO ILQGV WKDW VXFK VWUXFWXUH LV XQVDIH XQODZIXO RU EHFDXVHRIWKHGHJUHHWRZKLFKWKHVWUXFWXUHLVLQGLVUHSDLU RUODFNVPDLQWHQDQFHLVLQVDQLWDU\YHUPLQRUUDWLQIHVWHG FRQWDLQVILOWKDQGFRQWDPLQDWLRQRUODFNVYHQWLODWLRQLOOX PLQDWLRQVDQLWDU\RUKHDWLQJIDFLOLWLHVRURWKHUHVVHQWLDO HTXLSPHQWUHTXLUHGE\WKLVFRGHRUEHFDXVHWKHORFDWLRQ RIWKHVWUXFWXUHFRQVWLWXWHVDKD]DUGWRWKHRFFXSDQWVRIWKH VWUXFWXUHRUWRWKHSXEOLF 8QODZIXOVWUXFWXUH$QXQODZIXOVWUXFWXUHLVRQH IRXQGLQZKROHRULQSDUWWREHRFFXSLHGE\PRUHSHUVRQV WKDQSHUPLWWHGXQGHUWKLVFRGHRUZDVHUHFWHGDOWHUHGRU RFFXSLHGFRQWUDU\WRODZ 'DQJHURXVVWUXFWXUHRUSUHPLVHV)RUWKHSXU SRVHRIWKLVFRGHDQ\VWUXFWXUHRUSUHPLVHVWKDWKDVDQ\RU DOORIWKHFRQGLWLRQVRUGHIHFWVGHVFULEHGDVIROORZVVKDOO EHFRQVLGHUHGWREHGDQJHURXV $Q\ GRRU DLVOH SDVVDJHZD\ VWDLUZD\ H[LW RU RWKHUPHDQVRIHJUHVVWKDWGRHVQRWFRQIRUPWRWKH DSSURYHGEXLOGLQJRUILUHFRGHRIWKHMXULVGLFWLRQ DVUHODWHGWRWKHUHTXLUHPHQWVIRUH[LVWLQJEXLOG LQJV 7KH ZDONLQJ VXUIDFH RI DQ\ DLVOH SDVVDJHZD\ VWDLUZD\ H[LW RU RWKHU PHDQV RI HJUHVV LV VR ZDUSHGZRUQORRVHWRUQRURWKHUZLVHXQVDIHDVWR QRWSURYLGHVDIHDQGDGHTXDWHPHDQVRIHJUHVV $Q\ SRUWLRQRIDEXLOGLQJVWUXFWXUHRU DSSXUWH QDQFHWKDWKDVEHHQGDPDJHGE\ILUHHDUWKTXDNH ZLQGIORRGGHWHULRUDWLRQQHJOHFWDEDQGRQPHQW YDQGDOLVPRUE\DQ\RWKHUFDXVHWRVXFKDQH[WHQW WKDWLWLVOLNHO\WRSDUWLDOO\RUFRPSOHWHO\FROODSVH RUWREHFRPHGHWDFKHGRUGLVORGJHG $Q\SRUWLRQRIDEXLOGLQJRUDQ\PHPEHUDSSXU WHQDQFHRURUQDPHQWDWLRQRQWKHH[WHULRUWKHUHRI WKDWLVQRWRIVXIILFLHQWVWUHQJWKRUVWDELOLW\RULV QRWVRDQFKRUHGDWWDFKHGRUIDVWHQHGLQSODFHVR DVWREHFDSDEOHRIUHVLVWLQJQDWXUDORUDUWLILFLDO ORDGV RI RQH DQG RQHKDOI WKH RULJLQDO GHVLJQHG YDOXH 7KHEXLOGLQJRUVWUXFWXUHRUSDUWRIWKHEXLOGLQJRU VWUXFWXUH EHFDXVH RI GLODSLGDWLRQGHWHULRUDWLRQ GHFD\IDXOW\FRQVWUXFWLRQWKHUHPRYDORUPRYH PHQWRIVRPHSRUWLRQRIWKHJURXQGQHFHVVDU\IRU WKHVXSSRUWRUIRUDQ\RWKHUUHDVRQLVOLNHO\WR SDUWLDOO\RUFRPSOHWHO\FROODSVHRUVRPHSRUWLRQ RIWKHIRXQGDWLRQRUXQGHUSLQQLQJRIWKHEXLOGLQJ RUVWUXFWXUHLVOLNHO\WRIDLORUJLYHZD\ 7KHEXLOGLQJRUVWUXFWXUHRUDQ\SRUWLRQWKHUHRILV FOHDUO\XQVDIHIRULWVXVHDQGRFFXSDQF\ 7KHEXLOGLQJRUVWUXFWXUHLVQHJOHFWHGGDPDJHG GLODSLGDWHG XQVHFXUHG RU DEDQGRQHG VR DV WR EHFRPH DQ DWWUDFWLYH QXLVDQFH WR FKLOGUHQ ZKR PLJKWSOD\LQWKHEXLOGLQJRUVWUXFWXUHWRWKHLUGDQ JHUEHFRPHVDKDUERUIRUYDJUDQWVFULPLQDOVRU LPPRUDOSHUVRQVRUHQDEOHVSHUVRQVWRUHVRUWWR WKHEXLOGLQJRUVWUXFWXUHIRUFRPPLWWLQJDQXLVDQFH RUDQXQODZIXODFW Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 4 5 6 Page: 17 Number: 1 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 1:56:12 PM Number: 2 Author: Melissa P (2nd pass) Date: 12/23/2019 2:06:28 PM Number: 3 Author: MPoehlman Date: 12/23/2019 1:56:07 PM Number: 4 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:01:38 PM 107.7 Additional Applicable Code Sections. The City of Richfield reserves the right to utilize the enforcement and notice processes in Sections 320 and 925 of the Richfield City Code for nuisance and environmental health related violations. Number: 5 Author: MPoehlman Subject: Cross-Out Date: 1/14/2020 2:42:48 PM Number: 6 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:06:18 PM 108.1 General. MSBC Section 1300.0180 shall be used to evaluate unsafe structures and equipment. Enforcement shall be governed by Section 925 of the city code. 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( $Q\ EXLOGLQJ RU VWUXFWXUH KDV EHHQ FRQVWUXFWHG H[LVWVRULVPDLQWDLQHGLQYLRODWLRQRIDQ\VSHFLILF UHTXLUHPHQW RU SURKLELWLRQ DSSOLFDEOH WR VXFK EXLOGLQJ RU VWUXFWXUH SURYLGHG E\ WKHDSSURYHG EXLOGLQJRUILUHFRGHRIWKHMXULVGLFWLRQRURIDQ\ ODZRURUGLQDQFHWRVXFKDQH[WHQWDVWRSUHVHQW HLWKHUDVXEVWDQWLDOULVNRIILUHEXLOGLQJFROODSVHRU DQ\RWKHUWKUHDWWROLIHDQGVDIHW\ $ EXLOGLQJ RU VWUXFWXUH XVHG RU LQWHQGHG WR EH XVHGIRUGZHOOLQJSXUSRVHVEHFDXVHRILQDGHTXDWH PDLQWHQDQFHGLODSLGDWLRQGHFD\GDPDJHIDXOW\ FRQVWUXFWLRQ RU DUUDQJHPHQW LQDGHTXDWH OLJKW YHQWLODWLRQ PHFKDQLFDO RU SOXPELQJ V\VWHP RU RWKHUZLVHLVGHWHUPLQHGE\WKHFRGHRIILFLDOWREH XQVDQLWDU\XQILWIRUKXPDQKDELWDWLRQRULQVXFKD FRQGLWLRQWKDWLVOLNHO\WRFDXVHVLFNQHVVRUGLV HDVH $Q\EXLOGLQJRUVWUXFWXUHEHFDXVHRIDODFNRIVXI ILFLHQWRUSURSHUILUHUHVLVWDQFHUDWHGFRQVWUXFWLRQ ILUHSURWHFWLRQV\VWHPVHOHFWULFDOV\VWHPIXHOFRQ QHFWLRQVPHFKDQLFDOV\VWHPSOXPELQJV\VWHPRU RWKHUFDXVHLVGHWHUPLQHGE\WKHFRGHRIILFLDOWR EHDWKUHDWWROLIHRUKHDOWK $Q\SRUWLRQRIDEXLOGLQJUHPDLQVRQDVLWHDIWHU WKH GHPROLWLRQ RU GHVWUXFWLRQ RI WKH EXLOGLQJ RU VWUXFWXUHRUZKHQHYHUDQ\EXLOGLQJRUVWUXFWXUHLV DEDQGRQHGVRDVWRFRQVWLWXWHVXFKEXLOGLQJRUSRU WLRQWKHUHRIDVDQDWWUDFWLYHQXLVDQFHRUKD]DUGWR WKHSXEOLF &ORVLQJRIYDFDQWVWUXFWXUHV,IWKHVWUXFWXUHLVYDFDQW DQGXQILWIRUKXPDQKDELWDWLRQDQGRFFXSDQF\DQGLVQRWLQ GDQJHURIVWUXFWXUDOFROODSVHWKHFRGHRIILFLDOLVDXWKRUL]HGWR SRVWDSODFDUGRIFRQGHPQDWLRQRQWKHSUHPLVHVDQGRUGHUWKH VWUXFWXUHFORVHGXSVRDVQRWWREHDQDWWUDFWLYHQXLVDQFH 8SRQIDLOXUHRIWKHRZQHURURZQHU¶VDXWKRUL]HGDJHQWWR FORVHXSWKHSUHPLVHVZLWKLQWKHWLPHVSHFLILHGLQWKHRUGHU WKHFRGHRIILFLDOVKDOOFDXVHWKHSUHPLVHVWREHFORVHGDQG VHFXUHGWKURXJKDQ\DYDLODEOHSXEOLFDJHQF\RUE\FRQWUDFWRU DUUDQJHPHQWE\SULYDWHSHUVRQVDQGWKHFRVWWKHUHRIVKDOOEH FKDUJHGDJDLQVWWKHUHDOHVWDWHXSRQZKLFKWKHVWUXFWXUHLV ORFDWHGDQGVKDOOEHDOLHQXSRQVXFKUHDOHVWDWHDQGVKDOOEH FROOHFWHGE\DQ\RWKHUOHJDOUHVRXUFH $XWKRULW\ WR GLVFRQQHFW VHUYLFH XWLOLWLHV7KH FRGHRIILFLDOVKDOOKDYHWKHDXWKRULW\WRDXWKRUL]HGLVFRQ QHFWLRQRIXWLOLW\VHUYLFHWRWKHEXLOGLQJVWUXFWXUHRUV\V WHPUHJXODWHGE\WKLVFRGHDQGWKHUHIHUHQFHGFRGHVDQG VWDQGDUGVVHWIRUWKLQ6HFWLRQLQFDVHRIHPHUJHQF\ ZKHUHQHFHVVDU\WRHOLPLQDWHDQLPPHGLDWHKD]DUGWROLIH RU SURSHUW\ RU ZKHUH VXFK XWLOLW\ FRQQHFWLRQ KDV EHHQ PDGHZLWKRXWDSSURYDO7KHFRGHRIILFLDOVKDOOQRWLI\WKH VHUYLQJ XWLOLW\ DQG ZKHQHYHU SRVVLEOH WKHRZQHURU RZQHU¶VDXWKRUL]HGDJHQWDQGRFFXSDQWRIWKHEXLOGLQJ VWUXFWXUHRUVHUYLFHV\VWHPRIWKHGHFLVLRQWRGLVFRQQHFW SULRUWRWDNLQJVXFKDFWLRQ,IQRWQRWLILHGSULRUWRGLVFRQ QHFWLRQWKHRZQHURZQHU¶VDXWKRUL]HGDJHQWRURFFXSDQW RIWKHEXLOGLQJVWUXFWXUHRUVHUYLFHV\VWHPVKDOOEHQRWLILHG LQZULWLQJDVVRRQDVSUDFWLFDOWKHUHDIWHU 1RWLFH:KHQHYHUWKHFRGHRIILFLDOKDVFRQGHPQHGD VWUXFWXUHRUHTXLSPHQWXQGHUWKHSURYLVLRQVRIWKLVVHFWLRQ QRWLFHVKDOOEHSRVWHGLQDFRQVSLFXRXVSODFHLQRUDERXWWKH VWUXFWXUHDIIHFWHGE\VXFKQRWLFHDQGVHUYHGRQWKHRZQHU RZQHU¶VDXWKRUL]HGDJHQWRUWKHSHUVRQRUSHUVRQVUHVSRQVLEOH IRU WKH VWUXFWXUH RU HTXLSPHQW LQDFFRUGDQFH ZLWK6HFWLRQ ,IWKHQRWLFHSHUWDLQVWRHTXLSPHQWLWVKDOOEHSODFHG RQWKHFRQGHPQHGHTXLSPHQW7KHQRWLFHVKDOOEHLQWKHIRUP SUHVFULEHGLQ6HFWLRQ 3ODFDUGLQJ8SRQIDLOXUHRIWKHRZQHURZQHU¶VDXWKR UL]HGDJHQWRUSHUVRQUHVSRQVLEOHWRFRPSO\ZLWKWKHQRWLFH SURYLVLRQVZLWKLQWKHWLPHJLYHQWKHFRGHRIILFLDOVKDOOSRVW RQWKHSUHPLVHVRURQGHIHFWLYHHTXLSPHQWDSODFDUGEHDULQJ WKHZRUG³&RQGHPQHG´DQGDVWDWHPHQWRIWKHSHQDOWLHVSUR YLGHGIRURFFXS\LQJWKHSUHPLVHVRSHUDWLQJWKHHTXLSPHQWRU UHPRYLQJWKHSODFDUG 3ODFDUGUHPRYDO7KHFRGHRIILFLDOVKDOOUHPRYH WKHFRQGHPQDWLRQSODFDUGZKHQHYHUWKHGHIHFWRUGHIHFWV XSRQZKLFKWKHFRQGHPQDWLRQDQGSODFDUGLQJDFWLRQZHUH EDVHGKDYHEHHQHOLPLQDWHG$Q\SHUVRQZKRGHIDFHVRU UHPRYHVDFRQGHPQDWLRQSODFDUGZLWKRXWWKHDSSURYDORI WKHFRGHRIILFLDOVKDOOEHVXEMHFWWRWKHSHQDOWLHVSURYLGHG E\WKLVFRGH 3URKLELWHGRFFXSDQF\$Q\RFFXSLHGVWUXFWXUHFRQ GHPQHGDQGSODFDUGHGE\WKHFRGHRIILFLDOVKDOOEHYDFDWHGDV RUGHUHGE\WKHFRGHRIILFLDO$Q\SHUVRQZKRVKDOORFFXS\D SODFDUGHGSUHPLVHVRUVKDOORSHUDWHSODFDUGHGHTXLSPHQWDQG DQ\RZQHURZQHU¶VDXWKRUL]HGDJHQWRUSHUVRQUHVSRQVLEOH IRUWKHSUHPLVHVZKRVKDOOOHWDQ\RQHRFFXS\DSODFDUGHG SUHPLVHVRURSHUDWHSODFDUGHGHTXLSPHQWVKDOOEHOLDEOHIRU WKHSHQDOWLHVSURYLGHGE\WKLVFRGH $EDWHPHQWPHWKRGV7KHRZQHURZQHU¶VDXWKRUL]HG DJHQWRSHUDWRURURFFXSDQWRIDEXLOGLQJSUHPLVHVRUHTXLS PHQWGHHPHGXQVDIHE\WKHFRGHRIILFLDOVKDOODEDWHRUFDXVH WREHDEDWHGRUFRUUHFWHGVXFKXQVDIHFRQGLWLRQVHLWKHUE\ UHSDLUUHKDELOLWDWLRQGHPROLWLRQRURWKHUDSSURYHGFRUUHFWLYH DFWLRQ 5HFRUG7KHFRGHRIILFLDOVKDOOFDXVHDUHSRUWWREH ILOHGRQDQXQVDIHFRQGLWLRQ7KHUHSRUWVKDOOVWDWHWKHRFFX SDQF\RIWKHVWUXFWXUHDQGWKHQDWXUHRIWKHXQVDIHFRQGLWLRQ 6(&7,21 (0(5*(1&<0($685(6 ,PPLQHQWGDQJHU:KHQLQWKHRSLQLRQRIWKHFRGH RIILFLDOWKHUHLVLPPLQHQWGDQJHURIIDLOXUHRUFROODSVHRID EXLOGLQJRUVWUXFWXUHWKDWHQGDQJHUVOLIHRUZKHQDQ\VWUXF WXUHRUSDUWRIDVWUXFWXUHKDVIDOOHQDQGOLIHLVHQGDQJHUHGE\ WKHRFFXSDWLRQRIWKHVWUXFWXUHRUZKHQWKHUHLVDFWXDORU SRWHQWLDOGDQJHU WR WKHEXLOGLQJRFFXSDQWV RU WKRVHLQ WKH SUR[LPLW\RIDQ\VWUXFWXUHEHFDXVHRIH[SORVLYHVH[SORVLYH IXPHV RU YDSRUV RU WKH SUHVHQFH RI WR[LF IXPHV JDVHV RU PDWHULDOVRURSHUDWLRQRIGHIHFWLYHRUGDQJHURXVHTXLSPHQW WKHFRGHRIILFLDOLVKHUHE\DXWKRUL]HGDQGHPSRZHUHGWRRUGHU DQGUHTXLUHWKHRFFXSDQWVWRYDFDWHWKHSUHPLVHVIRUWKZLWK 7KHFRGHRIILFLDOVKDOOFDXVHWREHSRVWHGDWHDFKHQWUDQFHWR VXFKVWUXFWXUHDQRWLFHUHDGLQJDVIROORZV³7KLV6WUXFWXUH,V 8QVDIHDQG,WV2FFXSDQF\+DV%HHQ3URKLELWHGE\WKH&RGH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 Page: 18 Number: 1 Author: Melissa P (2nd pass) Date: 12/23/2019 2:06:53 PM Number: 2 Author: Melissa P (2nd pass) Date: 12/23/2019 2:08:01 PM Number: 3 Author: Melissa P (2nd pass) Date: 12/23/2019 2:07:39 PM 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 2IILFLDO´,WVKDOOEHXQODZIXOIRUDQ\SHUVRQWRHQWHUVXFK VWUXFWXUH H[FHSW IRU WKH SXUSRVH RI VHFXULQJ WKH VWUXFWXUH PDNLQJWKHUHTXLUHGUHSDLUVUHPRYLQJWKHKD]DUGRXVFRQGL WLRQRURIGHPROLVKLQJWKHVDPH 7HPSRUDU\VDIHJXDUGV1RWZLWKVWDQGLQJRWKHUSURYL VLRQVRIWKLVFRGHZKHQHYHULQWKHRSLQLRQRIWKHFRGHRIIL FLDOWKHUHLVLPPLQHQWGDQJHUGXHWRDQXQVDIHFRQGLWLRQWKH FRGH RIILFLDO VKDOO RUGHU WKH QHFHVVDU\ ZRUN WR EH GRQH LQFOXGLQJWKHERDUGLQJXSRIRSHQLQJVWRUHQGHUVXFKVWUXF WXUH WHPSRUDULO\ VDIH ZKHWKHU RU QRW WKH OHJDO SURFHGXUH KHUHLQ GHVFULEHG KDV EHHQ LQVWLWXWHG DQG VKDOO FDXVH VXFK RWKHUDFWLRQWREHWDNHQDVWKHFRGHRIILFLDOGHHPVQHFHVVDU\ WRPHHWVXFKHPHUJHQF\ &ORVLQJVWUHHWV:KHQQHFHVVDU\IRUSXEOLFVDIHW\WKH FRGHRIILFLDOVKDOOWHPSRUDULO\FORVHVWUXFWXUHVDQGFORVHRU RUGHUWKHDXWKRULW\KDYLQJMXULVGLFWLRQWRFORVHVLGHZDONV VWUHHWVSXEOLFZD\VDQGSODFHVDGMDFHQWWRXQVDIHVWUXFWXUHV DQGSURKLELWWKHVDPHIURPEHLQJXWLOL]HG (PHUJHQF\UHSDLUV)RUWKHSXUSRVHVRIWKLVVHFWLRQ WKHFRGHRIILFLDOVKDOOHPSOR\WKHQHFHVVDU\ODERUDQGPDWHUL DOVWRSHUIRUPWKHUHTXLUHGZRUNDVH[SHGLWLRXVO\DVSRVVLEOH &RVWVRIHPHUJHQF\UHSDLUV&RVWVLQFXUUHGLQWKHSHU IRUPDQFHRIHPHUJHQF\ZRUNVKDOOEHSDLGE\WKHMXULVGLF WLRQ 7KH OHJDO FRXQVHO RI WKH MXULVGLFWLRQ VKDOO LQVWLWXWH DSSURSULDWH DFWLRQ DJDLQVW WKHRZQHURIWKHSUHPLVHVRU RZQHU¶VDXWKRUL]HGDJHQWZKHUHWKHXQVDIHVWUXFWXUHLVRUZDV ORFDWHGIRUWKHUHFRYHU\RIVXFKFRVWV +HDULQJ$Q\SHUVRQRUGHUHGWRWDNHHPHUJHQF\PHD VXUHVVKDOOFRPSO\ZLWKVXFKRUGHUIRUWKZLWK$Q\DIIHFWHG SHUVRQVKDOOWKHUHDIWHUXSRQSHWLWLRQGLUHFWHGWRWKHDSSHDOV ERDUGEHDIIRUGHGDKHDULQJDVGHVFULEHGLQWKLVFRGH 6(&7,21 '(02/,7,21 *HQHUDO7KHFRGHRIILFLDOVKDOORUGHUWKHRZQHURU RZQHU¶V DXWKRUL]HG DJHQW RI DQ\SUHPLVHV XSRQ ZKLFK LV ORFDWHGDQ\VWUXFWXUHZKLFKLQWKHFRGHRIILFLDO¶VRURZQHU¶V DXWKRUL]HGDJHQWMXGJPHQWDIWHUUHYLHZLVVRGHWHULRUDWHGRU GLODSLGDWHGRUKDVEHFRPHVRRXWRIUHSDLUDVWREHGDQJHURXV XQVDIHLQVDQLWDU\RURWKHUZLVHXQILWIRUKXPDQKDELWDWLRQRU RFFXSDQF\ DQG VXFK WKDW LW LV XQUHDVRQDEOH WR UHSDLU WKH VWUXFWXUHWRGHPROLVKDQGUHPRYHVXFKVWUXFWXUHRULIVXFK VWUXFWXUHLVFDSDEOHRIEHLQJPDGHVDIHE\UHSDLUVWRUHSDLU DQGPDNHVDIHDQGVDQLWDU\RUWRERDUGXSDQGKROGIRUIXWXUH UHSDLURUWRGHPROLVKDQGUHPRYHDWWKHRZQHU¶VRSWLRQRU ZKHUHWKHUHKDVEHHQDFHVVDWLRQRIQRUPDOFRQVWUXFWLRQRI DQ\VWUXFWXUHIRUDSHULRGRIPRUHWKDQWZR\HDUVWKHFRGH RIILFLDOVKDOORUGHUWKHRZQHURURZQHU¶VDXWKRUL]HGDJHQWWR GHPROLVKDQGUHPRYHVXFKVWUXFWXUHRUERDUGXSXQWLOIXWXUH UHSDLU%RDUGLQJWKHEXLOGLQJXSIRUIXWXUHUHSDLUVKDOOQRW H[WHQG EH\RQG RQH \HDU XQOHVVDSSURYHG E\ WKH EXLOGLQJ RIILFLDO 1RWLFHVDQGRUGHUV1RWLFHVDQGRUGHUVVKDOOFRPSO\ ZLWK6HFWLRQ )DLOXUH WR FRPSO\,IWKHRZQHU RI DSUHPLVHVRU RZQHU¶VDXWKRUL]HGDJHQWIDLOVWRFRPSO\ZLWKDGHPROLWLRQ RUGHUZLWKLQWKHWLPHSUHVFULEHGWKHFRGHRIILFLDOVKDOOFDXVH WKHVWUXFWXUHWREHGHPROLVKHGDQGUHPRYHGHLWKHUWKURXJKDQ DYDLODEOHSXEOLFDJHQF\RUE\FRQWUDFWRUDUUDQJHPHQWZLWK SULYDWHSHUVRQVDQGWKHFRVWRIVXFKGHPROLWLRQDQGUHPRYDO VKDOOEHFKDUJHGDJDLQVWWKHUHDOHVWDWHXSRQZKLFKWKHVWUXF WXUHLVORFDWHGDQGVKDOOEHDOLHQXSRQVXFKUHDOHVWDWH 6DOYDJH PDWHULDOV:KHUHDQ\VWUXFWXUHKDVEHHQ RUGHUHG GHPROLVKHG DQG UHPRYHG WKH JRYHUQLQJ ERG\ RU RWKHUGHVLJQDWHGRIILFHUXQGHUVDLGFRQWUDFWRUDUUDQJHPHQW DIRUHVDLGVKDOOKDYHWKHULJKWWRVHOOWKHVDOYDJHDQGYDOXDEOH PDWHULDOV7KHQHWSURFHHGVRIVXFKVDOHDIWHUGHGXFWLQJWKH H[SHQVHVRIVXFKGHPROLWLRQDQGUHPRYDOVKDOOEHSURPSWO\ UHPLWWHGZLWKDUHSRUWRIVXFKVDOHRUWUDQVDFWLRQLQFOXGLQJ WKHLWHPVRIH[SHQVHDQGWKHDPRXQWVGHGXFWHGIRUWKHSHU VRQZKRLVHQWLWOHGWKHUHWRVXEMHFWWRDQ\RUGHURIDFRXUW,I VXFKDVXUSOXVGRHVQRWUHPDLQWREHWXUQHGRYHUWKHUHSRUW VKDOOVRVWDWH 6(&7,21 0($162)$33($/ >$@ $SSOLFDWLRQ IRU DSSHDO$Q\SHUVRQGLUHFWO\ DIIHFWHGE\DGHFLVLRQRIWKHFRGHRIILFLDORUDQRWLFHRURUGHU LVVXHGXQGHUWKLVFRGHVKDOOKDYHWKHULJKWWRDSSHDOWRWKH ERDUG RI DSSHDOV SURYLGHG WKDW D ZULWWHQ DSSOLFDWLRQ IRU DSSHDOLVILOHGZLWKLQGD\VDIWHUWKHGD\WKHGHFLVLRQ QRWLFHRURUGHUZDVVHUYHG$QDSSOLFDWLRQIRUDSSHDOVKDOOEH EDVHGRQDFODLPWKDWWKHWUXHLQWHQWRIWKLVFRGHRUWKHUXOHV OHJDOO\DGRSWHGWKHUHXQGHUKDYHEHHQLQFRUUHFWO\LQWHUSUHWHG WKHSURYLVLRQVRIWKLVFRGHGRQRWIXOO\DSSO\RUWKHUHTXLUH PHQWVRIWKLVFRGHDUHDGHTXDWHO\VDWLVILHGE\RWKHUPHDQV >$@0HPEHUVKLSRIERDUG7KHERDUGRIDSSHDOVVKDOO FRQVLVWRIQRWOHVVWKDQWKUHHPHPEHUVZKRDUHTXDOLILHGE\ H[SHULHQFHDQGWUDLQLQJWRSDVVRQPDWWHUVSHUWDLQLQJWRSURS HUW\PDLQWHQDQFHDQGZKRDUHQRWHPSOR\HHVRIWKHMXULVGLF WLRQ7KHFRGHRIILFLDOVKDOOEHDQH[RIILFLRPHPEHUEXWVKDOO QRWYRWHRQDQ\PDWWHUEHIRUHWKHERDUG7KHERDUGVKDOOEH DSSRLQWHGE\WKHFKLHIDSSRLQWLQJDXWKRULW\DQGVKDOOVHUYH VWDJJHUHGDQGRYHUODSSLQJWHUPV >$@ $OWHUQDWH PHPEHUV 7KH FKLHI DSSRLQWLQJ DXWKRULW\VKDOODSSRLQWQRWOHVVWKDQWZRDOWHUQDWHPHPEHUV ZKRVKDOOEHFDOOHGE\WKHERDUGFKDLUPDQWRKHDUDSSHDOV GXULQJWKHDEVHQFHRUGLVTXDOLILFDWLRQRIDPHPEHU$OWHU QDWHPHPEHUVVKDOOSRVVHVVWKHTXDOLILFDWLRQVUHTXLUHGIRU ERDUGPHPEHUVKLS >$@&KDLUPDQ7KHERDUGVKDOODQQXDOO\VHOHFW RQHRILWVPHPEHUVWRVHUYHDVFKDLUPDQ >$@'LVTXDOLILFDWLRQRIPHPEHU$PHPEHUVKDOO QRWKHDUDQDSSHDOLQZKLFKWKDWPHPEHUKDVDSHUVRQDO SURIHVVLRQDORUILQDQFLDOLQWHUHVW >$@ 6HFUHWDU\ 7KHFKLHI DGPLQLVWUDWLYH RIILFHU VKDOOGHVLJQDWHDTXDOLILHGSHUVRQWRVHUYHDVVHFUHWDU\WR WKHERDUG7KHVHFUHWDU\VKDOOILOHDGHWDLOHGUHFRUGRIDOO SURFHHGLQJVLQWKHRIILFHRIWKHFKLHIDGPLQLVWUDWLYHRIIL FHU >$@&RPSHQVDWLRQRIPHPEHUV&RPSHQVDWLRQ RIPHPEHUVVKDOOEHGHWHUPLQHGE\ODZ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 Page: 19 Number: 1 Author: Melissa P (2nd pass) Date: 12/23/2019 2:14:23 PM per the provisions of Section 320 of the city code. Number: 2 Author: MPoehlman Subject: Cross-Out Date: 1/14/2020 2:47:15 PM Number: 3 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 2:11:59 PM 6&23($1'$'0,1,675$7,21 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( >$@ 1RWLFH RI PHHWLQJ 7KH ERDUG VKDOO PHHW XSRQ QRWLFHIURPWKHFKDLUPDQZLWKLQGD\VRIWKHILOLQJRIDQ DSSHDORUDWVWDWHGSHULRGLFPHHWLQJV >$@2SHQKHDULQJ+HDULQJVEHIRUHWKHERDUGVKDOOEH RSHQWRWKHSXEOLF7KHDSSHOODQWWKHDSSHOODQW¶VUHSUHVHQWD WLYH WKHFRGH RIILFLDO DQG DQ\ SHUVRQ ZKRVH LQWHUHVWV DUH DIIHFWHGVKDOOEHJLYHQDQRSSRUWXQLW\WREHKHDUG$TXRUXP VKDOOFRQVLVWRIQRWOHVVWKDQWZRWKLUGVRIWKHERDUGPHPEHU VKLS >$@3URFHGXUH7KHERDUGVKDOODGRSWDQGPDNH DYDLODEOHWRWKHSXEOLFWKURXJKWKHVHFUHWDU\SURFHGXUHV XQGHUZKLFKDKHDULQJZLOOEHFRQGXFWHG7KHSURFHGXUHV VKDOOQRWUHTXLUHFRPSOLDQFHZLWKVWULFWUXOHVRIHYLGHQFH EXW VKDOO PDQGDWH WKDW RQO\ UHOHYDQW LQIRUPDWLRQ EH UHFHLYHG >$@3RVWSRQHGKHDULQJ:KHQWKHIXOOERDUGLVQRW SUHVHQWWRKHDUDQDSSHDOHLWKHUWKHDSSHOODQWRUWKHDSSHO ODQW¶VUHSUHVHQWDWLYHVKDOOKDYHWKHULJKWWRUHTXHVWDSRVW SRQHPHQWRIWKHKHDULQJ >$@%RDUGGHFLVLRQ7KHERDUGVKDOOPRGLI\RUUHYHUVH WKHGHFLVLRQRIWKHFRGHRIILFLDORQO\E\DFRQFXUULQJYRWHRID PDMRULW\RIWKHWRWDOQXPEHURIDSSRLQWHGERDUGPHPEHUV >$@ 5HFRUGV DQG FRSLHV 7KH GHFLVLRQ RI WKH ERDUGVKDOOEHUHFRUGHG&RSLHVVKDOOEHIXUQLVKHGWRWKH DSSHOODQWDQGWRWKHFRGHRIILFLDO >$@$GPLQLVWUDWLRQ7KHFRGHRIILFLDOVKDOOWDNH LPPHGLDWHDFWLRQLQDFFRUGDQFHZLWKWKHGHFLVLRQRIWKH ERDUG >$@&RXUWUHYLHZ$Q\SHUVRQZKHWKHURUQRWDSUHYL RXVSDUW\RIWKHDSSHDOVKDOOKDYHWKHULJKWWRDSSO\WRWKH DSSURSULDWHFRXUWIRUDZULWRIFHUWLRUDULWRFRUUHFWHUURUVRI ODZ$SSOLFDWLRQIRUUHYLHZVKDOOEHPDGHLQWKHPDQQHUDQG WLPHUHTXLUHGE\ODZIROORZLQJWKHILOLQJRIWKHGHFLVLRQLQ WKHRIILFHRIWKHFKLHIDGPLQLVWUDWLYHRIILFHU >$@ 6WD\V RI HQIRUFHPHQW $SSHDOV RI QRWLFH DQG RUGHUVRWKHUWKDQ,PPLQHQW'DQJHUQRWLFHVVKDOOVWD\WKH HQIRUFHPHQWRIWKHQRWLFHDQGRUGHUXQWLOWKHDSSHDOLVKHDUG E\WKHDSSHDOVERDUG 6(&7,21 6723:25.25'(5 >$@$XWKRULW\:KHQHYHUWKHFRGHRIILFLDOILQGVDQ\ ZRUNUHJXODWHGE\WKLVFRGHEHLQJSHUIRUPHGLQDPDQQHU FRQWUDU\WRWKHSURYLVLRQVRIWKLVFRGHRULQDGDQJHURXVRU XQVDIHPDQQHUWKHFRGHRIILFLDOLVDXWKRUL]HGWRLVVXHDVWRS ZRUNRUGHU >$@,VVXDQFH$VWRSZRUNRUGHUVKDOOEHLQZULWLQJDQG VKDOOEHJLYHQWRWKHRZQHURIWKHSURSHUW\WRWKHRZQHU¶V DXWKRUL]HGDJHQWRUWRWKHSHUVRQGRLQJWKHZRUN8SRQLVVX DQFHRIDVWRSZRUNRUGHUWKHFLWHGZRUNVKDOOLPPHGLDWHO\ FHDVH7KHVWRSZRUNRUGHUVKDOOVWDWHWKHUHDVRQIRUWKHRUGHU DQGWKHFRQGLWLRQVXQGHUZKLFKWKHFLWHGZRUNLVDXWKRUL]HG WRUHVXPH >$@ (PHUJHQFLHV :KHUH DQ HPHUJHQF\ H[LVWV WKH FRGHRIILFLDOVKDOOQRWEHUHTXLUHGWRJLYHDZULWWHQQRWLFH SULRUWRVWRSSLQJWKHZRUN >$@)DLOXUHWRFRPSO\$Q\SHUVRQZKRVKDOOFRQWLQXH DQ\ZRUNDIWHUKDYLQJEHHQVHUYHGZLWKDVWRSZRUNRUGHU H[FHSWVXFK ZRUNDVWKDWSHUVRQLVGLUHFWHGWRSHUIRUP WR UHPRYHDYLRODWLRQRUXQVDIHFRQGLWLRQVKDOOEHOLDEOHWRD ILQHRIQRWOHVVWKDQ>$02817@GROODUVRUPRUHWKDQ>$02817@ GROODUV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 Page: 20 Number: 1 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 2:10:22 PM Number: 2 Author: Melissa P (2nd pass) Date: 12/23/2019 2:10:59 PM Number: 3 Author: Melissa P (2nd pass) Date: 12/23/2019 2:10:56 PM ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 '(),1,7,216 User note: About this chapter:Codes, by their very nature, are technical documents. Every word, term and punctuation mark can add to or change the meaning of a technical requirement. It is necessary to maintain a consensus on the specific meaning of each term contained in the code. Chapter 2 performs this function by stating clearly what specific terms mean for the purpose of the code. 6(&7,21 *(1(5$/ 6FRSH8QOHVVRWKHUZLVHH[SUHVVO\VWDWHGWKHIROORZ LQJWHUPVVKDOOIRUWKHSXUSRVHVRIWKLVFRGHKDYHWKHPHDQ LQJVVKRZQLQWKLVFKDSWHU ,QWHUFKDQJHDELOLW\:RUGVVWDWHGLQWKHSUHVHQWWHQVH LQFOXGH WKH IXWXUH ZRUGV VWDWHG LQ WKH PDVFXOLQH JHQGHU LQFOXGHWKHIHPLQLQHDQGQHXWHUWKHVLQJXODUQXPEHULQFOXGHV WKHSOXUDODQGWKHSOXUDOWKHVLQJXODU 7HUPVGHILQHGLQRWKHUFRGHV:KHUHWHUPVDUHQRW GHILQHG LQ WKLV FRGH DQG DUH GHILQHG LQ WKH,QWHUQDWLRQDO %XLOGLQJ&RGH,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ&RGH,QWHU QDWLRQDO)LUH&RGH,QWHUQDWLRQDO)XHO*DV&RGH,QWHUQD WLRQDO 0HFKDQLFDO &RGH ,QWHUQDWLRQDO 3OXPELQJ &RGH ,QWHUQDWLRQDO5HVLGHQWLDO&RGH,QWHUQDWLRQDO=RQLQJ&RGHRU 1)3$VXFKWHUPVVKDOOKDYHWKHPHDQLQJVDVFULEHGWR WKHPDVVWDWHGLQWKRVHFRGHV 7HUPV QRW GHILQHG :KHUH WHUPV DUH QRW GHILQHG WKURXJKWKHPHWKRGVDXWKRUL]HGE\WKLVVHFWLRQVXFKWHUPV VKDOOKDYHRUGLQDULO\DFFHSWHGPHDQLQJVVXFKDVWKHFRQWH[W LPSOLHV 3DUWV:KHQHYHUWKHZRUGV³GZHOOLQJXQLW´³GZHOO LQJ´ ³SUHPLVHV´ ³EXLOGLQJ´ ³URRPLQJ KRXVH´ ³URRPLQJ XQLW´³KRXVHNHHSLQJXQLW´RU³VWRU\´DUHVWDWHGLQWKLVFRGH WKH\VKDOOEHFRQVWUXHGDVWKRXJKWKH\ZHUHIROORZHGE\WKH ZRUGV³RUDQ\SDUWWKHUHRI´ 6(&7,21 *(1(5$/'(),1,7,216 $1&+25('6HFXUHGLQDPDQQHUWKDWSURYLGHVSRVLWLYH FRQQHFWLRQ >$@$33529('$FFHSWDEOHWRWKHFRGHRIILFLDO %$6(0(17 7KDW SRUWLRQ RI DEXLOGLQJ WKDW LV SDUWO\ RU FRPSOHWHO\EHORZJUDGH %$7+5220$URRPFRQWDLQLQJSOXPELQJIL[WXUHVLQFOXG LQJDEDWKWXERUVKRZHU %('5220$Q\URRPRUVSDFHXVHGRULQWHQGHGWREHXVHG IRUVOHHSLQJSXUSRVHVLQHLWKHUDGZHOOLQJRUVOHHSLQJXQLW >$@&2'(2)),&,$/7KHRIILFLDOZKRLVFKDUJHGZLWKWKH DGPLQLVWUDWLRQ DQG HQIRUFHPHQW RI WKLV FRGH RU DQ\ GXO\ DXWKRUL]HGUHSUHVHQWDWLYH &21'(017RDGMXGJHXQILWIRURFFXSDQF\ &267 2) 68&+ '(02/,7,21 25 (0(5*(1&< 5(3$,567KHFRVWVVKDOOLQFOXGHWKHDFWXDOFRVWVRIWKH GHPROLWLRQRUUHSDLURIWKHVWUXFWXUHOHVVUHYHQXHVREWDLQHGLI VDOYDJHZDVFRQGXFWHGSULRUWRGHPROLWLRQRUUHSDLU&RVWV VKDOO LQFOXGH EXW QRW EH OLPLWHG WR H[SHQVHV LQFXUUHG RU QHFHVVLWDWHGUHODWHGWRGHPROLWLRQRUHPHUJHQF\UHSDLUVVXFK DV DVEHVWRV VXUYH\ DQG DEDWHPHQW LI QHFHVVDU\ FRVWV RI LQVSHFWRUVWHVWLQJDJHQFLHVRUH[SHUWVUHWDLQHGUHODWLYHWRWKH GHPROLWLRQRUHPHUJHQF\UHSDLUVFRVWVRIWHVWLQJVXUYH\VIRU RWKHUPDWHULDOVWKDWDUHFRQWUROOHGRUUHJXODWHGIURPEHLQJ GXPSHG LQ D ODQGILOO WLWOH VHDUFKHV PDLOLQJV SRVWLQJV UHFRUGLQJDQGDWWRUQH\IHHVH[SHQGHGIRUUHFRYHULQJRIWKH FRVWRIHPHUJHQF\UHSDLUVRUWRREWDLQRUHQIRUFHDQRUGHURI GHPROLWLRQPDGHE\DFRGHRIILFLDOWKHJRYHUQLQJERG\RU ERDUGRIDSSHDOV '(7$&+(':KHQDVWUXFWXUDOHOHPHQWLVSK\VLFDOO\GLV FRQQHFWHGIURPDQRWKHUDQGWKDWFRQQHFWLRQLVQHFHVVDU\WR SURYLGHDSRVLWLYHFRQQHFWLRQ '(7(5,25$7,217RZHDNHQGLVLQWHJUDWHFRUURGHUXVW RUGHFD\DQGORVHHIIHFWLYHQHVV >%*@':(//,1*81,7$VLQJOHXQLWSURYLGLQJFRPSOHWH LQGHSHQGHQWOLYLQJIDFLOLWLHVIRURQHRUPRUHSHUVRQVLQFOXG LQJSHUPDQHQWSURYLVLRQVIRUOLYLQJVOHHSLQJHDWLQJFRRNLQJ DQGVDQLWDWLRQ >=@($6(0(177KDWSRUWLRQRIODQGRUSURSHUW\UHVHUYHG IRUSUHVHQWRUIXWXUHXVHE\DSHUVRQRUDJHQF\RWKHUWKDQWKH OHJDOIHHRZQHUVRIWKHSURSHUW\7KHHDVHPHQWVKDOOEHSHU PLWWHGWREHIRUXVHXQGHURQRUDERYHVDLGORWRUORWV (48,30(17 68332577KRVH VWUXFWXUDO PHPEHUV RU DVVHPEOLHVRIPHPEHUVRUPDQXIDFWXUHGHOHPHQWVLQFOXGLQJ EUDFHVIUDPHVOXJVVQXJJHUVKDQJHUVRUVDGGOHVWKDWWUDQV PLWJUDYLW\ORDGODWHUDOORDGDQGRSHUDWLQJORDGEHWZHHQWKH HTXLSPHQWDQGWKHVWUXFWXUH (;7(5,253523(57<7KHRSHQVSDFHRQWKHSUHPLVHV DQG RQ DGMRLQLQJ SURSHUW\ XQGHU WKH FRQWURO RIRZQHUVRU RSHUDWRUVRIVXFKSUHPLVHV *$5%$*(7KHDQLPDORUYHJHWDEOHZDVWHUHVXOWLQJIURP WKHKDQGOLQJSUHSDUDWLRQFRRNLQJDQGFRQVXPSWLRQRIIRRG >%(@*8$5'$EXLOGLQJFRPSRQHQWRUDV\VWHPRIEXLOG LQJFRPSRQHQWVORFDWHGDWRUQHDUWKHRSHQVLGHVRIHOHYDWHG ZDONLQJVXUIDFHVWKDWPLQLPL]HVWKHSRVVLELOLW\RIDIDOOIURP WKHZDONLQJVXUIDFHWRDORZHUOHYHO >%*@+$%,7$%/(63$&(6SDFHLQDVWUXFWXUHIRUOLYLQJ VOHHSLQJHDWLQJRUFRRNLQJ%DWKURRPVWRLOHWURRPVFORVHWV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 7HUPV GHILQHG LQ RWKHU FRGHV :KHUH WHUPV DUH QRW GHILQHG LQ WKLV FRGH DQG DUH GHILQHG LQ WKH ,QWHUQDWLRQDO %XLOGLQJ &RGH ,QWHUQDWLRQDO ([LVWLQJ %XLOGLQJ &RGH ,QWHU QDWLRQDO )LUH &RGH ,QWHUQDWLRQDO )XHO *DV &RGH ,QWHUQD WLRQDO 0HFKDQLFDO &RGH ,QWHUQDWLRQDO 3OXPELQJ &RGH ,QWHUQDWLRQDO 5HVLGHQWLDO &RGH ,QWHUQDWLRQDO =RQLQJ &RGH RU 1)3$ VXFK WHUPV VKDOO KDYH WKH PHDQLQJV DVFULEHG WR WKHP DV VWDWHG LQ WKRVH FRGHV 1 2 3 Page: 22 Number: 1 Author: MPoehlman Subject: Replace Date: 1/14/2020 2:56:53 PM 201.3. Terms defined in other codes. Where terms are not defined in this code and are defined in the MSBC and the City Code, such terms shall have the meanings ascribed to them in those codes. Number: 2 Author: Melissa P (2nd pass) Date: 12/23/2019 2:22:01 PM (also see "Rubbish." Garbage and Rubbish shall be taken to encompass both definitions herein.) Author: Jennifer Date: 10/9/2019 12:44:08 PM -05'00' city code section 601 is currently being amended by Rachel Lindholm to eliminate the definition of refuse and change the definition of garbage among other changes. Mary is aware of this but we need to make sure this all meshes. Number: 3 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:22:25 PM (Also see "Rubbish." Garbage and Rubbish shall be taken to encompass both definitions herein.) '(),1,7,216 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( KDOOVVWRUDJHRUXWLOLW\VSDFHVDQGVLPLODUDUHDVDUHQRWFRQ VLGHUHGKDELWDEOHVSDFHV +,6725,&%8,/',1*$Q\EXLOGLQJRUVWUXFWXUHWKDWLV RQHRUPRUHRIWKHIROORZLQJ /LVWHGRUFHUWLILHGDVHOLJLEOHIRUOLVWLQJE\WKH6WDWH +LVWRULF 3UHVHUYDWLRQ 2IILFHU RU WKH .HHSHU RI WKH 1DWLRQDO5HJLVWHURI+LVWRULF3ODFHVLQWKH1DWLRQDO 5HJLVWHURI+LVWRULF3ODFHV 'HVLJQDWHGDVKLVWRULFXQGHUDQDSSOLFDEOHVWDWHRUORFDO ODZ &HUWLILHGDVDFRQWULEXWLQJUHVRXUFHZLWKLQD1DWLRQDO 5HJLVWHURUVWDWHRUORFDOO\GHVLJQDWHGKLVWRULFGLVWULFW +286(.((3,1*81,7$URRPRUJURXSRIURRPVIRUP LQJDVLQJOHKDELWDEOHVSDFHHTXLSSHGDQGLQWHQGHGWREHXVHG IRUOLYLQJVOHHSLQJFRRNLQJDQGHDWLQJWKDWGRHVQRWFRQWDLQ ZLWKLQVXFKDXQLWDWRLOHWODYDWRU\DQGEDWKWXERUVKRZHU ,00,1(17'$1*(5$FRQGLWLRQWKDWFRXOGFDXVHVHUL RXVRUOLIHWKUHDWHQLQJLQMXU\RUGHDWKDWDQ\WLPH ,1)(67$7,217KHSUHVHQFHZLWKLQRUFRQWLJXRXVWRD VWUXFWXUH RUSUHPLVHV RI LQVHFWV URGHQWV YHUPLQ RU RWKHU SHVWV ,123(5$%/(027259(+,&/($YHKLFOHWKDWFDQQRW EHGULYHQXSRQWKHSXEOLFVWUHHWVIRUUHDVRQLQFOXGLQJEXWQRW OLPLWHGWREHLQJXQOLFHQVHGZUHFNHGDEDQGRQHGLQDVWDWHRI GLVUHSDLURULQFDSDEOHRIEHLQJPRYHGXQGHULWVRZQSRZHU >$@/$%(/('(TXLSPHQWPDWHULDOVRUSURGXFWVWRZKLFK KDYHEHHQDIIL[HGDODEHOVHDOV\PERORURWKHULGHQWLI\LQJ PDUNRIDQDWLRQDOO\UHFRJQL]HGWHVWLQJODERUDWRU\DSSURYHG DJHQF\RURWKHURUJDQL]DWLRQFRQFHUQHGZLWKSURGXFWHYDOXD WLRQWKDWPDLQWDLQVSHULRGLFLQVSHFWLRQRIWKHSURGXFWLRQRI WKHDERYHODEHOHGLWHPVDQGZKRVHODEHOLQJLQGLFDWHVHLWKHU WKDWWKHHTXLSPHQWPDWHULDORUSURGXFWPHHWVLGHQWLILHGVWDQ GDUGVRUKDVEHHQWHVWHGDQGIRXQGVXLWDEOHIRUDVSHFLILHG SXUSRVH /(7)252&&83$1&<RU/(77RSHUPLWSURYLGHRU RIIHUSRVVHVVLRQRURFFXSDQF\RIDGZHOOLQJGZHOOLQJXQLW URRPLQJXQLWEXLOGLQJSUHPLVHRUVWUXFWXUHE\DSHUVRQZKR LVRULVQRWWKHOHJDORZQHURIUHFRUGWKHUHRISXUVXDQWWRD ZULWWHQRUXQZULWWHQOHDVHDJUHHPHQWRUOLFHQVHRUSXUVXDQW WRDUHFRUGHGRUXQUHFRUGHGDJUHHPHQWRIFRQWUDFWIRUWKHVDOH RIODQG 1(*/(&77KHODFNRISURSHUPDLQWHQDQFHIRUDEXLOGLQJ RUVWUXFWXUH >$@2&&83$1&<7KHSXUSRVHIRU ZKLFK DEXLOGLQJRU SRUWLRQWKHUHRILVXWLOL]HGRURFFXSLHG 2&&83$17$Q\LQGLYLGXDOOLYLQJRUVOHHSLQJLQDEXLOG LQJRUKDYLQJSRVVHVVLRQRIDVSDFHZLWKLQDEXLOGLQJ 23(1$%/( $5($ 7KDW SDUW RI D ZLQGRZ VN\OLJKW RU GRRU ZKLFK LV DYDLODEOH IRU XQREVWUXFWHGYHQWLODWLRQDQG ZKLFKRSHQVGLUHFWO\WRWKHRXWGRRUV 23(5$725$Q\SHUVRQZKRKDVFKDUJHFDUHRUFRQWURORI DVWUXFWXUHRUSUHPLVHVWKDWLVOHWRURIIHUHGIRURFFXSDQF\ >$@2:1(5$Q\SHUVRQDJHQWRSHUDWRUILUPRUFRUSRUD WLRQ KDYLQJ OHJDO RU HTXLWDEOH LQWHUHVW LQ WKH SURSHUW\ RU UHFRUGHGLQWKHRIILFLDOUHFRUGVRIWKHVWDWHFRXQW\RUPXQLFL SDOLW\DVKROGLQJWLWOHWRWKHSURSHUW\RURWKHUZLVHKDYLQJ FRQWURORIWKHSURSHUW\LQFOXGLQJWKHJXDUGLDQRIWKHHVWDWHRI DQ\ VXFK SHUVRQ DQG WKH H[HFXWRU RU DGPLQLVWUDWRU RIWKH HVWDWHRIVXFKSHUVRQLIRUGHUHGWRWDNHSRVVHVVLRQRIUHDO SURSHUW\E\DFRXUW 3(5621 $Q LQGLYLGXDO FRUSRUDWLRQ SDUWQHUVKLS RU DQ\ RWKHUJURXSDFWLQJDVDXQLW 3(67 (/,0,1$7,21 7KH FRQWURO DQG HOLPLQDWLRQ RI LQVHFWVURGHQWVRURWKHUSHVWVE\HOLPLQDWLQJWKHLUKDUERUDJH SODFHVE\ UHPRYLQJ RUPDNLQJ LQDFFHVVLEOH PDWHULDOV WKDW VHUYHDVWKHLUIRRGRUZDWHUE\RWKHUDSSURYHGSHVWHOLPLQD WLRQPHWKRGV >$@35(0,6(6$ORWSORWRUSDUFHORIODQGHDVHPHQWRU SXEOLFZD\LQFOXGLQJDQ\VWUXFWXUHVWKHUHRQ >$@38%/,&:$<$Q\VWUHHWDOOH\RURWKHUSDUFHORIODQG WKDWLVRSHQWRWKHRXWVLGHDLUOHDGVWRDVWUHHWKDVEHHQ GHHGHGGHGLFDWHGRURWKHUZLVHSHUPDQHQWO\DSSURSULDWHGWR WKHSXEOLFIRUSXEOLFXVHDQGKDVDFOHDUZLGWKDQGKHLJKWRI QRWOHVVWKDQIHHWPP 5220,1*+286($EXLOGLQJDUUDQJHGRURFFXSLHGIRU ORGJLQJZLWK RU ZLWKRXW PHDOV IRUFRPSHQVDWLRQ DQG QRW RFFXSLHGDVDRQHRUWZRIDPLO\GZHOOLQJ 5220,1*81,7$Q\URRPRUJURXSRIURRPVIRUPLQJD VLQJOHKDELWDEOHXQLWRFFXSLHGRULQWHQGHGWREHRFFXSLHGIRU VOHHSLQJRUOLYLQJEXWQRWIRUFRRNLQJSXUSRVHV 58%%,6+&RPEXVWLEOHDQGQRQFRPEXVWLEOHZDVWHPDWHUL DOVH[FHSWJDUEDJHWKHWHUPVKDOOLQFOXGHWKHUHVLGXHIURP WKHEXUQLQJRIZRRGFRDOFRNHDQGRWKHUFRPEXVWLEOHPDWH ULDOV SDSHU UDJV FDUWRQV ER[HV ZRRG H[FHOVLRU UXEEHU OHDWKHUWUHHEUDQFKHV\DUGWULPPLQJVWLQFDQVPHWDOVPLQ HUDOPDWWHUJODVVFURFNHU\DQGGXVWDQGRWKHUVLPLODUPDWHUL DOV >%*@6/((3,1*81,7$URRPRUVSDFHLQZKLFKSHRSOH VOHHSZKLFKFDQDOVRLQFOXGHSHUPDQHQWSURYLVLRQVIRUOLY LQJHDWLQJDQGHLWKHUVDQLWDWLRQRUNLWFKHQIDFLOLWLHVEXWQRW ERWK6XFKURRPVDQGVSDFHVWKDWDUHDOVRSDUWRIDGZHOOLQJ XQLWDUHQRWVOHHSLQJXQLWV 675,&7/,$%,/,7<2))(16($QRIIHQVHLQZKLFKWKH SURVHFXWLRQLQDOHJDOSURFHHGLQJLV QRWUHTXLUHGWRSURYH FULPLQDOLQWHQWDVDSDUWRILWVFDVH,WLVHQRXJKWRSURYHWKDW WKHGHIHQGDQWHLWKHUGLGDQDFWZKLFKZDVSURKLELWHGRUIDLOHG WRGRDQDFWZKLFKWKHGHIHQGDQWZDVOHJDOO\UHTXLUHGWRGR >$@6758&785(7KDWZKLFKLVEXLOWRUFRQVWUXFWHG 7(1$17 $ SHUVRQ FRUSRUDWLRQ SDUWQHUVKLS RU JURXS ZKHWKHURUQRWWKHOHJDORZQHURIUHFRUGRFFXS\LQJDEXLOG LQJRUSRUWLRQWKHUHRIDVDXQLW 72,/(75220$URRPFRQWDLQLQJDZDWHUFORVHWRUXULQDO EXWQRWDEDWKWXERUVKRZHU 8/7,0$7('()250$7,217KHGHIRUPDWLRQDWZKLFK IDLOXUHRFFXUVDQGWKDWVKDOOEHGHHPHGWRRFFXULIWKHVXVWDLQ DEOH ORDG UHGXFHV WR SHUFHQW RU OHVV RI WKH PD[LPXP VWUHQJWK >0@9(17,/$7,217KHQDWXUDORUPHFKDQLFDOSURFHVVRI VXSSO\LQJFRQGLWLRQHGRUXQFRQGLWLRQHGDLUWRRUUHPRYLQJ VXFKDLUIURPDQ\VSDFH :25.0$1/,.(([HFXWHGLQDVNLOOHGPDQQHUHJJHQ HUDOO\SOXPEOHYHOVTXDUHLQOLQHXQGDPDJHGDQGZLWKRXW PDUULQJDGMDFHQWZRUN >=@<$5'$QRSHQVSDFHRQWKHVDPHORWZLWKDVWUXFWXUH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 Page: 23 Number: 1 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:23:09 PM (also see "Garbage." Garbage and Rubbish shall be taken to encompass both definitions herein.) ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 *(1(5$/5(48,5(0(176 User note: About this chapter: Chapter 3 is broad in scope and includes a variety of requirements for the maintenance of exterior property areas, as well as the interior and exterior elements of the structure, that are intended to maintain a minimum level of safety and sanitation for both the general public and the occupants of a structure, and to maintain a building’s structural and weather-resistance performance. Specifically, Chapter 3 contains criteria for the maintenance of building components; vacant structures and land; the safety, sanitation and appearance of the interior and exterior of structures and all exterior property areas; accessory structures; extermination of insects and rodents; access barri- ers to swimming pools, spas and hot tubs; vehicle storage and owner/occupant responsibilities. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPFRQGLWLRQVDQGWKHUHVSRQVLELOLWLHVRISHUVRQVIRU PDLQWHQDQFHRIVWUXFWXUHVHTXLSPHQWDQGH[WHULRUSURSHUW\ 5HVSRQVLELOLW\7KHRZQHURIWKHSUHPLVHVVKDOOPDLQ WDLQWKHVWUXFWXUHVDQGH[WHULRUSURSHUW\LQFRPSOLDQFHZLWK WKHVHUHTXLUHPHQWVH[FHSWDVRWKHUZLVHSURYLGHGIRULQWKLV FRGH$SHUVRQVKDOOQRWRFFXS\DVRZQHURFFXSDQWRUSHUPLW DQRWKHUSHUVRQWRRFFXS\SUHPLVHVWKDWDUHQRWLQDVDQLWDU\ DQGVDIHFRQGLWLRQDQGWKDWGRQRWFRPSO\ZLWKWKHUHTXLUH PHQWVRIWKLVFKDSWHU2FFXSDQWVRIDGZHOOLQJXQLWURRPLQJ XQLWRUKRXVHNHHSLQJXQLWDUHUHVSRQVLEOHIRUNHHSLQJLQD FOHDQVDQLWDU\DQGVDIHFRQGLWLRQWKDWSDUWRIWKHGZHOOLQJ XQLWURRPLQJ XQLWKRXVHNHHSLQJ XQLWRUSUHPLVHVWKH\ RFFXS\DQGFRQWURO 9DFDQWVWUXFWXUHVDQGODQG9DFDQWVWUXFWXUHVDQG SUHPLVHV WKHUHRI RU YDFDQW ODQG VKDOO EH PDLQWDLQHG LQ D FOHDQVDIHVHFXUHDQGVDQLWDU\FRQGLWLRQDVSURYLGHGKHUHLQ VRDVQRWWRFDXVHDEOLJKWLQJSUREOHPRUDGYHUVHO\DIIHFWWKH SXEOLFKHDOWKRUVDIHW\ 6(&7,21 (;7(5,253523(57<$5($6 6DQLWDWLRQ([WHULRUSURSHUW\DQGSUHPLVHVVKDOOEH PDLQWDLQHGLQDFOHDQVDIHDQGVDQLWDU\FRQGLWLRQ7KHRFFX SDQWVKDOONHHSWKDWSDUWRIWKHH[WHULRUSURSHUW\WKDWVXFK RFFXSDQWRFFXSLHVRUFRQWUROVLQDFOHDQDQGVDQLWDU\FRQGL WLRQ *UDGLQJDQGGUDLQDJH3UHPLVHVVKDOOEHJUDGHGDQG PDLQWDLQHGWRSUHYHQWWKHHURVLRQRIVRLODQGWRSUHYHQWWKH DFFXPXODWLRQRIVWDJQDQWZDWHUWKHUHRQRUZLWKLQDQ\VWUXF WXUHORFDWHGWKHUHRQ ([FHSWLRQ$SSURYHGUHWHQWLRQDUHDVDQGUHVHUYRLUV 6LGHZDONV DQG GULYHZD\V 6LGHZDONV ZDONZD\V VWDLUVGULYHZD\VSDUNLQJVSDFHVDQGVLPLODUDUHDVVKDOOEH NHSWLQDSURSHUVWDWHRIUHSDLUDQGPDLQWDLQHGIUHHIURPKD] DUGRXVFRQGLWLRQV :HHGV3UHPLVHVDQGH[WHULRUSURSHUW\VKDOOEHPDLQ WDLQHGIUHHIURPZHHGVRUSODQWJURZWKLQH[FHVVRI>-85,6 ',&7,2172,16(57+(,*+7,1,1&+(6@1R[LRXVZHHGVVKDOO EHSURKLELWHG:HHGVVKDOOEHGHILQHGDVDOOJUDVVHVDQQXDO SODQWVDQGYHJHWDWLRQRWKHUWKDQWUHHVRUVKUXEVSURYLGHG KRZHYHUWKLVWHUPVKDOOQRWLQFOXGHFXOWLYDWHGIORZHUVDQG JDUGHQV 8SRQIDLOXUHRIWKHRZQHURUDJHQWKDYLQJFKDUJHRID SURSHUW\WRFXWDQGGHVWUR\ZHHGVDIWHUVHUYLFHRIDQRWLFHRI YLRODWLRQWKH\VKDOOEHVXEMHFWWRSURVHFXWLRQLQDFFRUGDQFH ZLWK6HFWLRQDQGDVSUHVFULEHGE\WKHDXWKRULW\KDYLQJ MXULVGLFWLRQ8SRQIDLOXUHWRFRPSO\ZLWKWKHQRWLFHRIYLROD WLRQDQ\GXO\DXWKRUL]HGHPSOR\HHRIWKHMXULVGLFWLRQRUFRQ WUDFWRUKLUHGE\WKHMXULVGLFWLRQVKDOOEHDXWKRUL]HGWRHQWHU XSRQWKHSURSHUW\LQYLRODWLRQDQGFXWDQGGHVWUR\WKHZHHGV JURZLQJWKHUHRQDQGWKHFRVWVRIVXFKUHPRYDOVKDOOEHSDLG E\WKHRZQHURUDJHQWUHVSRQVLEOHIRUWKHSURSHUW\ 5RGHQWKDUERUDJH6WUXFWXUHVDQGH[WHULRUSURSHUW\ VKDOO EH NHSW IUHH IURP URGHQW KDUERUDJH DQGLQIHVWDWLRQ :KHUH URGHQWVDUHIRXQG WKH\ VKDOOEHSURPSWO\H[WHUPL QDWHG E\DSSURYHG SURFHVVHV WKDW ZLOO QRW EH LQMXULRXV WR KXPDQ KHDOWK $IWHU SHVW HOLPLQDWLRQ SURSHU SUHFDXWLRQV VKDOOEHWDNHQWRHOLPLQDWHURGHQWKDUERUDJHDQGSUHYHQWUHLQ IHVWDWLRQ ([KDXVWYHQWV3LSHVGXFWVFRQGXFWRUVIDQVRUEORZ HUVVKDOOQRWGLVFKDUJHJDVHVVWHDPYDSRUKRWDLUJUHDVH VPRNHRGRUVRURWKHUJDVHRXVRUSDUWLFXODWHZDVWHVGLUHFWO\ RQDEXWWLQJRUDGMDFHQWSXEOLFRUSULYDWHSURSHUW\RUWKDWRI DQRWKHUWHQDQW $FFHVVRU\VWUXFWXUHV$FFHVVRU\VWUXFWXUHVLQFOXGLQJ GHWDFKHG JDUDJHV IHQFHV DQG ZDOOV VKDOO EH PDLQWDLQHG VWUXFWXUDOO\VRXQGDQGLQJRRGUHSDLU 0RWRUYHKLFOHV([FHSWDVSURYLGHGIRULQRWKHUUHJXOD WLRQVLQRSHUDWLYHRUXQOLFHQVHGPRWRUYHKLFOHVVKDOOQRWEH SDUNHGNHSWRUVWRUHGRQDQ\SUHPLVHVDQGYHKLFOHVVKDOOQRW DWDQ\WLPHEHLQDVWDWHRIPDMRUGLVDVVHPEO\GLVUHSDLURULQ WKHSURFHVVRIEHLQJVWULSSHGRUGLVPDQWOHG3DLQWLQJRIYHKL FOHVLVSURKLELWHGXQOHVVFRQGXFWHGLQVLGHDQDSSURYHGVSUD\ ERRWK ([FHSWLRQ$YHKLFOHRIDQ\W\SHLVSHUPLWWHGWRXQGHUJR PDMRURYHUKDXOLQFOXGLQJERG\ZRUNSURYLGHGWKDWVXFK ZRUNLVSHUIRUPHGLQVLGHDVWUXFWXUHRUVLPLODUO\HQFORVHG DUHDGHVLJQHGDQGDSSURYHGIRUVXFKSXUSRVHV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 3 Page: 24 Number: 1 Author: MPoehlman Date: 12/23/2019 2:25:00 PM Number: 2 Author: MPoehlman Subject: Inserted Text Date: 1/14/2020 3:14:39 PM ...as provided in Section 925.02 of the city code. Number: 3 Author: MPoehlman Date: 12/23/2019 2:26:53 PM If we need to Reference the city code we will be using here, it is City Code 925.06 *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 'HIDFHPHQWRISURSHUW\$SHUVRQVKDOOQRWZLOOIXOO\ RUZDQWRQO\GDPDJHPXWLODWHRUGHIDFHDQ\H[WHULRUVXUIDFH RIDQ\VWUXFWXUHRUEXLOGLQJRQDQ\SULYDWHRUSXEOLFSURSHUW\ E\SODFLQJWKHUHRQDQ\PDUNLQJFDUYLQJRUJUDIILWL ,WVKDOOEHWKHUHVSRQVLELOLW\RIWKHRZQHUWRUHVWRUHVDLG VXUIDFHWRDQDSSURYHGVWDWHRIPDLQWHQDQFHDQGUHSDLU 6(&7,21 6:,00,1*322/663$6$1'+2778%6 6ZLPPLQJ SRROV 6ZLPPLQJ SRROV VKDOO EH PDLQ WDLQHGLQDFOHDQDQGVDQLWDU\FRQGLWLRQDQGLQJRRGUHSDLU (QFORVXUHV3ULYDWHVZLPPLQJSRROVKRWWXEVDQG VSDV FRQWDLQLQJ ZDWHU PRUH WKDQ LQFKHV PP LQ GHSWKVKDOOEHFRPSOHWHO\VXUURXQGHGE\DIHQFHRUEDUULHU QRWOHVVWKDQLQFKHVPPLQKHLJKWDERYHWKHILQ LVKHGJURXQGOHYHOPHDVXUHGRQWKHVLGHRIWKHEDUULHUDZD\ IURPWKHSRRO*DWHVDQGGRRUVLQVXFKEDUULHUVVKDOOEHVHOI FORVLQJDQGVHOIODWFKLQJ:KHUHWKHVHOIODWFKLQJGHYLFHLV OHVVWKDQLQFKHVPPDERYHWKHERWWRPRIWKHJDWH WKHUHOHDVHPHFKDQLVPVKDOOEHORFDWHGRQWKHSRROVLGHRIWKH JDWH6HOIFORVLQJDQGVHOIODWFKLQJJDWHVVKDOOEHPDLQWDLQHG VXFK WKDW WKH JDWH ZLOO SRVLWLYHO\ FORVH DQG ODWFK ZKHQ UHOHDVHGIURPDQRSHQSRVLWLRQRILQFKHVPPIURPWKH JDWHSRVW$QH[LVWLQJSRROHQFORVXUHVKDOOQRWEHUHPRYHG UHSODFHGRUFKDQJHGLQDPDQQHUWKDWUHGXFHVLWVHIIHFWLYHQHVV DVDVDIHW\EDUULHU ([FHSWLRQ6SDVRUKRWWXEVZLWKDVDIHW\FRYHUWKDWFRP SOLHVZLWK$670)VKDOOEHH[HPSWIURPWKHSURYL VLRQVRIWKLVVHFWLRQ 6(&7,21 (;7(5,256758&785( *HQHUDO 7KH H[WHULRURID VWUXFWXUH VKDOO EH PDLQ WDLQHGLQJRRGUHSDLUVWUXFWXUDOO\VRXQGDQGVDQLWDU\VRDVQRW WRSRVHDWKUHDWWRWKHSXEOLFKHDOWKVDIHW\RUZHOIDUH 8QVDIH FRQGLWLRQV 7KH IROORZLQJ FRQGLWLRQV VKDOO EH GHWHUPLQHG DV XQVDIH DQG VKDOO EH UHSDLUHG RU UHSODFHGWRFRPSO\ZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH RUWKH,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ&RGHDVUHTXLUHGIRU H[LVWLQJEXLOGLQJV 7KHQRPLQDOVWUHQJWKRIDQ\VWUXFWXUDOPHPEHULV H[FHHGHGE\QRPLQDOORDGVWKHORDGHIIHFWVRUWKH UHTXLUHGVWUHQJWK 7KHDQFKRUDJHRIWKHIORRURUURRIWRZDOOVRUFRO XPQVDQGRIZDOOVDQGFROXPQVWRIRXQGDWLRQVLV QRWFDSDEOHRIUHVLVWLQJDOOQRPLQDOORDGVRUORDG HIIHFWV 6WUXFWXUHV RU FRPSRQHQWV WKHUHRI WKDW KDYH UHDFKHGWKHLUOLPLWVWDWH 6LGLQJ DQG PDVRQU\ MRLQWV LQFOXGLQJ MRLQWV EHWZHHQWKHEXLOGLQJHQYHORSHDQGWKHSHULPHWHU RI ZLQGRZV GRRUV DQG VN\OLJKWV DUH QRW PDLQ WDLQHGZHDWKHUUHVLVWDQWRUZDWHUWLJKW 6WUXFWXUDOPHPEHUVWKDWKDYHHYLGHQFHRIGHWHULR UDWLRQRUWKDWDUHQRWFDSDEOHRIVDIHO\VXSSRUWLQJ DOOQRPLQDOORDGVDQGORDGHIIHFWV )RXQGDWLRQV\VWHPVWKDWDUHQRWILUPO\VXSSRUWHG E\ IRRWLQJV DUH QRW SOXPE DQG IUHH IURP RSHQ FUDFNVDQGEUHDNVDUHQRWSURSHUO\DQFKRUHGRU DUH QRW FDSDEOH RI VXSSRUWLQJ DOO QRPLQDO ORDGV DQGUHVLVWLQJDOOORDGHIIHFWV ([WHULRUZDOOVWKDWDUHQRWDQFKRUHGWRVXSSRUWLQJ DQGVXSSRUWHGHOHPHQWVRUDUHQRWSOXPEDQGIUHH RI KROHV FUDFNV RU EUHDNV DQG ORRVH RU URWWLQJ PDWHULDOV DUH QRW SURSHUO\ DQFKRUHG RU DUH QRW FDSDEOHRIVXSSRUWLQJDOOQRPLQDOORDGVDQGUHVLVW LQJDOOORDGHIIHFWV 5RRILQJRUURRILQJFRPSRQHQWVWKDWKDYHGHIHFWV WKDW DGPLW UDLQ URRI VXUIDFHV ZLWK LQDGHTXDWH GUDLQDJHRUDQ\SRUWLRQRIWKHURRIIUDPLQJWKDWLV QRW LQ JRRG UHSDLU ZLWK VLJQV RIGHWHULRUDWLRQ IDWLJXHRUZLWKRXWSURSHUDQFKRUDJHDQGLQFDSDEOH RIVXSSRUWLQJDOOQRPLQDOORDGVDQGUHVLVWLQJDOO ORDGHIIHFWV )ORRULQJ DQG IORRULQJ FRPSRQHQWV ZLWK GHIHFWV WKDWDIIHFWVHUYLFHDELOLW\RUIORRULQJFRPSRQHQWV WKDWVKRZVLJQVRIGHWHULRUDWLRQRUIDWLJXHDUHQRW SURSHUO\DQFKRUHGRUDUHLQFDSDEOHRIVXSSRUWLQJ DOOQRPLQDOORDGVDQGUHVLVWLQJDOOORDGHIIHFWV 9HQHHUFRUQLFHVEHOWFRXUVHVFRUEHOVWULPZDOO IDFLQJVDQGVLPLODUGHFRUDWLYHIHDWXUHVQRWSURS HUO\DQFKRUHGRUWKDWDUHDQFKRUHGZLWKFRQQHF WLRQVQRWFDSDEOHRIVXSSRUWLQJDOOQRPLQDOORDGV DQGUHVLVWLQJDOOORDGHIIHFWV 2YHUKDQJH[WHQVLRQVRUSURMHFWLRQVLQFOXGLQJEXW QRWOLPLWHGWRWUDVKFKXWHVFDQRSLHVPDUTXHHV VLJQV DZQLQJV ILUH HVFDSHV VWDQGSLSHV DQG H[KDXVWGXFWVQRWSURSHUO\DQFKRUHGRUWKDWDUH DQFKRUHGZLWKFRQQHFWLRQVQRWFDSDEOHRIVXSSRUW LQJDOOQRPLQDOORDGVDQGUHVLVWLQJDOOORDGHIIHFWV ([WHULRUVWDLUVGHFNVSRUFKHVEDOFRQLHVDQGDOO VLPLODUDSSXUWHQDQFHVDWWDFKHGWKHUHWRLQFOXGLQJ JXDUGVDQGKDQGUDLOVDUHQRWVWUXFWXUDOO\VRXQG QRWSURSHUO\DQFKRUHGRUWKDWDUHDQFKRUHGZLWK FRQQHFWLRQVQRWFDSDEOHRIVXSSRUWLQJDOOQRPLQDO ORDGVDQGUHVLVWLQJDOOORDGHIIHFWV &KLPQH\VFRROLQJWRZHUVVPRNHVWDFNVDQGVLPL ODU DSSXUWHQDQFHV QRW VWUXFWXUDOO\ VRXQG RU QRW SURSHUO\DQFKRUHGRUWKDWDUHDQFKRUHGZLWKFRQ QHFWLRQV QRW FDSDEOH RI VXSSRUWLQJ DOO QRPLQDO ORDGVDQGUHVLVWLQJDOOORDGHIIHFWV ([FHSWLRQV :KHUH VXEVWDQWLDWHG RWKHUZLVH E\ DQDSSURYHG PHWKRG 'HPROLWLRQRIXQVDIHFRQGLWLRQVVKDOOEHSHUPLW WHGZKHUHDSSURYHGE\WKHFRGHRIILFLDO 3URWHFWLYHWUHDWPHQW([WHULRUVXUIDFHVLQFOXGLQJEXW QRW OLPLWHG WR GRRUV GRRU DQG ZLQGRZ IUDPHV FRUQLFHV SRUFKHV WULP EDOFRQLHV GHFNVDQGIHQFHV VKDOO EH PDLQ WDLQHGLQJRRGFRQGLWLRQ([WHULRUZRRGVXUIDFHVRWKHUWKDQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 Page: 25 Number: 1 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:28:42 PM ...within 48 hours or as designated by the Code Official. *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( GHFD\UHVLVWDQWZRRGVVKDOOEHSURWHFWHGIURPWKHHOHPHQWV DQGGHFD\E\SDLQWLQJRURWKHUSURWHFWLYHFRYHULQJRUWUHDW PHQW3HHOLQJIODNLQJDQGFKLSSHGSDLQWVKDOOEHHOLPLQDWHG DQGVXUIDFHVUHSDLQWHG6LGLQJDQGPDVRQU\MRLQWVDVZHOODV WKRVH EHWZHHQ WKH EXLOGLQJ HQYHORSH DQG WKH SHULPHWHU RI ZLQGRZVGRRUVDQGVN\OLJKWVVKDOOEHPDLQWDLQHGZHDWKHU UHVLVWDQWDQGZDWHUWLJKW0HWDOVXUIDFHVVXEMHFWWRUXVWRUFRU URVLRQVKDOOEHFRDWHGWRLQKLELWVXFKUXVWDQGFRUURVLRQDQG VXUIDFHVZLWKUXVWRUFRUURVLRQVKDOOEHVWDELOL]HGDQGFRDWHG WRLQKLELWIXWXUHUXVWDQGFRUURVLRQ2[LGDWLRQVWDLQVVKDOOEH UHPRYHGIURPH[WHULRUVXUIDFHV6XUIDFHVGHVLJQHGIRUVWDELOL ]DWLRQE\R[LGDWLRQDUHH[HPSWIURPWKLVUHTXLUHPHQW >)@ 3UHPLVHV LGHQWLILFDWLRQ %XLOGLQJV VKDOO KDYH DSSURYHGDGGUHVVQXPEHUVSODFHGLQDSRVLWLRQWREHSODLQO\ OHJLEOHDQGYLVLEOHIURPWKHVWUHHWRUURDGIURQWLQJWKHSURS HUW\ 7KHVH QXPEHUV VKDOO FRQWUDVW ZLWK WKHLU EDFNJURXQG $GGUHVVQXPEHUVVKDOOEH$UDELFQXPHUDOVRUDOSKDEHWOHW WHUV1XPEHUVVKDOOEHQRWOHVVWKDQLQFKHVPPLQ KHLJKWZLWKDPLQLPXPVWURNHZLGWKRILQFKPP 6WUXFWXUDO PHPEHUV 6WUXFWXUDO PHPEHUV VKDOO EH PDLQWDLQHGIUHHIURPGHWHULRUDWLRQDQGVKDOOEHFDSDEOHRI VDIHO\VXSSRUWLQJWKHLPSRVHGGHDGDQGOLYHORDGV )RXQGDWLRQZDOOV)RXQGDWLRQZDOOV VKDOO EHPDLQ WDLQHGSOXPEDQGIUHHIURPRSHQFUDFNVDQGEUHDNVDQGVKDOO EHNHSWLQVXFKFRQGLWLRQVRDVWRSUHYHQWWKHHQWU\RIURGHQWV DQGRWKHUSHVWV ([WHULRUZDOOV([WHULRUZDOOVVKDOOEHIUHHIURPKROHV EUHDNVDQGORRVHRUURWWLQJPDWHULDOVDQGPDLQWDLQHGZHDWK HUSURRIDQGSURSHUO\VXUIDFHFRDWHGZKHUHUHTXLUHGWRSUH YHQWGHWHULRUDWLRQ 5RRIVDQGGUDLQDJH7KHURRIDQGIODVKLQJVKDOOEH VRXQGWLJKWDQGQRWKDYHGHIHFWVWKDWDGPLWUDLQ5RRIGUDLQ DJHVKDOOEHDGHTXDWHWRSUHYHQWGDPSQHVVRUGHWHULRUDWLRQLQ WKHZDOOVRULQWHULRUSRUWLRQRIWKHVWUXFWXUH5RRIGUDLQVJXW WHUVDQGGRZQVSRXWVVKDOOEHPDLQWDLQHGLQJRRGUHSDLUDQG IUHHIURPREVWUXFWLRQV5RRIZDWHUVKDOOQRWEHGLVFKDUJHGLQ DPDQQHUWKDWFUHDWHVDSXEOLFQXLVDQFH 'HFRUDWLYHIHDWXUHV&RUQLFHVEHOWFRXUVHVFRUEHOV WHUUDFRWWDWULPZDOOIDFLQJVDQGVLPLODUGHFRUDWLYHIHDWXUHV VKDOOEHPDLQWDLQHGLQJRRGUHSDLUZLWKSURSHUDQFKRUDJHDQG LQDVDIHFRQGLWLRQ 2YHUKDQJH[WHQVLRQV2YHUKDQJH[WHQVLRQVLQFOXGLQJ EXWQRWOLPLWHGWRFDQRSLHVPDUTXHHVVLJQVPHWDODZQLQJV ILUHHVFDSHVVWDQGSLSHVDQGH[KDXVWGXFWVVKDOOEHPDLQWDLQHG LQJRRGUHSDLUDQGEHSURSHUO\DQFKRUHGVRDVWREHNHSWLQD VRXQG FRQGLWLRQ :KHUH UHTXLUHG DOO H[SRVHG VXUIDFHV RI PHWDO RU ZRRG VKDOO EH SURWHFWHG IURP WKH HOHPHQWV DQG DJDLQVWGHFD\RUUXVWE\SHULRGLFDSSOLFDWLRQRIZHDWKHUFRDW LQJPDWHULDOVVXFKDVSDLQWRUVLPLODUVXUIDFHWUHDWPHQW 6WDLUZD\V GHFNV SRUFKHV DQG EDOFRQLHV(YHU\ H[WHULRUVWDLUZD\GHFNSRUFKDQGEDOFRQ\DQGDOODSSXUWH QDQFHV DWWDFKHG WKHUHWR VKDOO EH PDLQWDLQHG VWUXFWXUDOO\ VRXQGLQJRRGUHSDLUZLWKSURSHUDQFKRUDJHDQGFDSDEOHRI VXSSRUWLQJWKHLPSRVHGORDGV &KLPQH\VDQGWRZHUV&KLPQH\VFRROLQJWRZHUV VPRNHVWDFNVDQGVLPLODUDSSXUWHQDQFHVVKDOOEHPDLQWDLQHG VWUXFWXUDOO\VDIHDQGVRXQGDQGLQJRRGUHSDLU([SRVHGVXU IDFHVRIPHWDORUZRRGVKDOOEHSURWHFWHGIURPWKHHOHPHQWV DQGDJDLQVWGHFD\RUUXVWE\SHULRGLFDSSOLFDWLRQRIZHDWKHU FRDWLQJPDWHULDOVVXFKDVSDLQWRUVLPLODUVXUIDFHWUHDWPHQW +DQGUDLOV DQG JXDUGV (YHU\ KDQGUDLO DQGJXDUG VKDOOEHILUPO\IDVWHQHGDQGFDSDEOHRIVXSSRUWLQJQRUPDOO\ LPSRVHGORDGVDQGVKDOOEHPDLQWDLQHGLQJRRGFRQGLWLRQ :LQGRZVN\OLJKWDQGGRRUIUDPHV(YHU\ZLQGRZ VN\OLJKWGRRUDQGIUDPHVKDOOEHNHSWLQVRXQGFRQGLWLRQ JRRGUHSDLUDQGZHDWKHUWLJKW *OD]LQJ*OD]LQJPDWHULDOVVKDOOEHPDLQWDLQHG IUHHIURPFUDFNVDQGKROHV 2SHQDEOHZLQGRZV(YHU\ZLQGRZRWKHUWKDQD IL[HG ZLQGRZ VKDOO EH HDVLO\ RSHQDEOH DQG FDSDEOH RI EHLQJKHOGLQSRVLWLRQE\ZLQGRZKDUGZDUH ,QVHFW VFUHHQV 'XULQJ WKH SHULRG IURP>'$7(@WR >'$7(@ HYHU\ GRRU ZLQGRZ DQG RWKHU RXWVLGH RSHQLQJ UHTXLUHGIRUYHQWLODWLRQRIKDELWDEOHURRPVIRRGSUHSDUDWLRQ DUHDVIRRGVHUYLFHDUHDVRUDQ\DUHDVZKHUHSURGXFWVWREH LQFOXGHGRUXWLOL]HGLQIRRGIRUKXPDQFRQVXPSWLRQDUHSUR FHVVHGPDQXIDFWXUHGSDFNDJHGRUVWRUHGVKDOOEHVXSSOLHG ZLWKDSSURYHGWLJKWO\ILWWLQJVFUHHQVRIPLQLPXPPHVK SHULQFKPHVKSHUPPDQGHYHU\VFUHHQGRRUXVHGIRU LQVHFWFRQWUROVKDOOKDYHDVHOIFORVLQJGHYLFHLQJRRGZRUN LQJFRQGLWLRQ ([FHSWLRQ 6FUHHQV VKDOO QRW EH UHTXLUHG ZKHUH RWKHU DSSURYHGPHDQVVXFKDVDLUFXUWDLQVRULQVHFWUHSHOOHQW IDQVDUHHPSOR\HG 'RRUV([WHULRUGRRUVGRRUDVVHPEOLHVRSHUDWRUV\V WHPVLISURYLGHGDQGKDUGZDUHVKDOOEHPDLQWDLQHGLQJRRG FRQGLWLRQ/RFNVDWDOOHQWUDQFHVWRGZHOOLQJXQLWVDQGVOHHS LQJXQLWVVKDOOWLJKWO\VHFXUHWKHGRRU/RFNVRQPHDQVRI HJUHVVGRRUVVKDOOEHLQDFFRUGDQFHZLWK6HFWLRQ %DVHPHQW KDWFKZD\V (YHU\EDVHPHQWKDWFKZD\ VKDOOEHPDLQWDLQHGWRSUHYHQWWKHHQWUDQFHRIURGHQWVUDLQ DQGVXUIDFHGUDLQDJHZDWHU *XDUGV IRU EDVHPHQW ZLQGRZV (YHU\EDVHPHQW ZLQGRZWKDWLVRSHQDEOHVKDOOEHVXSSOLHGZLWKURGHQWVKLHOGV VWRUPZLQGRZVRURWKHUDSSURYHGSURWHFWLRQDJDLQVWWKHHQWU\ RIURGHQWV %XLOGLQJVHFXULW\'RRUVZLQGRZVRUKDWFKZD\VIRU GZHOOLQJXQLWVURRPXQLWVRUKRXVHNHHSLQJXQLWVVKDOOEHSUR YLGHGZLWKGHYLFHVGHVLJQHGWRSURYLGHVHFXULW\IRUWKHRFFX SDQWVDQGSURSHUW\ZLWKLQ 'RRUV 'RRUV SURYLGLQJ DFFHVV WR DGZHOOLQJ XQLWURRPLQJ XQLWRUKRXVHNHHSLQJ XQLW WKDW LV UHQWHG OHDVHG RU OHW VKDOO EH HTXLSSHG ZLWK D GHDGEROW ORFN GHVLJQHGWREHUHDGLO\RSHQDEOHIURPWKHVLGHIURPZKLFK HJUHVVLVWREHPDGHZLWKRXWWKHQHHGIRUNH\VVSHFLDO NQRZOHGJHRUHIIRUWDQGVKDOOKDYHDPLQLPXPORFNWKURZ RILQFKPP6XFKGHDGEROWORFNVVKDOOEHLQVWDOOHG DFFRUGLQJWRWKHPDQXIDFWXUHU¶VVSHFLILFDWLRQVDQGPDLQ WDLQHGLQJRRGZRUNLQJRUGHU)RUWKHSXUSRVHRIWKLVVHF WLRQDVOLGLQJEROWVKDOOQRWEHFRQVLGHUHGDQDFFHSWDEOH GHDGEROWORFN :LQGRZV2SHUDEOHZLQGRZVORFDWHGLQZKROH RULQSDUWZLWKLQIHHWPPDERYHJURXQGOHYHORUD Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 2 Page: 26 Number: 1 Author: MPoehlman Subject: Inserted Text Date: 1/15/2020 10:19:18 AM ...if on more than 20% of one side of any surface or building. Number: 2 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:31:50 PM 304.14 Insect screens. Every door... *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( ZDONLQJVXUIDFHEHORZWKDWSURYLGHDFFHVVWRDGZHOOLQJ XQLWURRPLQJ XQLWRUKRXVHNHHSLQJ XQLW WKDW LV UHQWHG OHDVHGRUOHWVKDOOEHHTXLSSHGZLWKDZLQGRZVDVKORFNLQJ GHYLFH %DVHPHQWKDWFKZD\V%DVHPHQWKDWFKZD\VWKDW SURYLGHDFFHVVWRDGZHOOLQJXQLWURRPLQJXQLWRUKRXVH NHHSLQJXQLWWKDWLVUHQWHGOHDVHGRUOHWVKDOOEHHTXLSSHG ZLWKGHYLFHVWKDWVHFXUHWKHXQLWVIURPXQDXWKRUL]HGHQWU\ *DWHV([WHULRUJDWHVJDWHDVVHPEOLHVRSHUDWRUV\V WHPVLISURYLGHGDQGKDUGZDUHVKDOOEHPDLQWDLQHGLQJRRG FRQGLWLRQ /DWFKHV DW DOO HQWUDQFHV VKDOO WLJKWO\ VHFXUH WKH JDWHV 6(&7,21 ,17(5,256758&785( *HQHUDO 7KH LQWHULRU RI D VWUXFWXUH DQG HTXLSPHQW WKHUHLQVKDOOEHPDLQWDLQHGLQJRRGUHSDLUVWUXFWXUDOO\VRXQG DQGLQDVDQLWDU\FRQGLWLRQ2FFXSDQWVVKDOONHHSWKDWSDUWRI WKHVWUXFWXUHWKDWWKH\RFFXS\RUFRQWUROLQDFOHDQDQGVDQL WDU\FRQGLWLRQ(YHU\RZQHURIDVWUXFWXUHFRQWDLQLQJDURRP LQJKRXVHKRXVHNHHSLQJXQLWVDKRWHODGRUPLWRU\WZRRU PRUHGZHOOLQJXQLWVRUWZRRUPRUHQRQUHVLGHQWLDORFFXSDQ FLHVVKDOOPDLQWDLQLQDFOHDQDQGVDQLWDU\FRQGLWLRQWKH VKDUHGRUSXEOLFDUHDVRIWKHVWUXFWXUHDQGH[WHULRUSURSHUW\ 8QVDIH FRQGLWLRQV 7KH IROORZLQJ FRQGLWLRQV VKDOO EH GHWHUPLQHG DV XQVDIH DQG VKDOO EH UHSDLUHG RU UHSODFHGWRFRPSO\ZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH RUWKH,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ&RGHDVUHTXLUHGIRU H[LVWLQJEXLOGLQJV 7KHQRPLQDOVWUHQJWKRIDQ\VWUXFWXUDOPHPEHULV H[FHHGHGE\QRPLQDOORDGVWKHORDGHIIHFWVRUWKH UHTXLUHGVWUHQJWK 7KHDQFKRUDJHRIWKHIORRURUURRIWRZDOOVRUFRO XPQVDQGRIZDOOVDQGFROXPQVWRIRXQGDWLRQVLV QRWFDSDEOHRIUHVLVWLQJDOOQRPLQDOORDGVRUORDG HIIHFWV 6WUXFWXUHVRUFRPSRQHQWVWKHUHRIWKDWKDYHUHDFKHG WKHLUOLPLWVWDWH 6WUXFWXUDO PHPEHUV DUH LQFDSDEOH RI VXSSRUWLQJ QRPLQDOORDGVDQGORDGHIIHFWV 6WDLUVODQGLQJVEDOFRQLHVDQGDOOVLPLODUZDONLQJ VXUIDFHV LQFOXGLQJJXDUGV DQG KDQGUDLOV DUH QRW VWUXFWXUDOO\ VRXQG QRW SURSHUO\DQFKRUHGRU DUH DQFKRUHGZLWKFRQQHFWLRQVQRWFDSDEOHRIVXSSRUW LQJDOOQRPLQDOORDGVDQGUHVLVWLQJDOOORDGHIIHFWV )RXQGDWLRQV\VWHPVWKDWDUHQRWILUPO\VXSSRUWHGE\ IRRWLQJVDUHQRWSOXPEDQGIUHHIURPRSHQFUDFNV DQG EUHDNV DUH QRW SURSHUO\DQFKRUHGRUDUHQRW FDSDEOHRIVXSSRUWLQJDOOQRPLQDOORDGVDQGUHVLVWLQJ DOOORDGHIIHFWV ([FHSWLRQV :KHUH VXEVWDQWLDWHG RWKHUZLVH E\ DQDSSURYHG PHWKRG 'HPROLWLRQRIXQVDIHFRQGLWLRQVVKDOOEHSHUPLW WHGZKHUHDSSURYHGE\WKHFRGHRIILFLDO 6WUXFWXUDO PHPEHUV6WUXFWXUDO PHPEHUV VKDOO EH PDLQWDLQHGVWUXFWXUDOO\VRXQGDQGEHFDSDEOHRIVXSSRUWLQJ WKHLPSRVHGORDGV ,QWHULRU VXUIDFHV ,QWHULRU VXUIDFHV LQFOXGLQJ ZLQ GRZVDQGGRRUVVKDOOEHPDLQWDLQHGLQJRRGFOHDQDQGVDQL WDU\ FRQGLWLRQ 3HHOLQJ FKLSSLQJ IODNLQJ RU DEUDGHG SDLQW VKDOOEHUHSDLUHGUHPRYHGRUFRYHUHG&UDFNHGRUORRVHSODV WHU GHFD\HG ZRRG DQG RWKHU GHIHFWLYH VXUIDFH FRQGLWLRQV VKDOOEHFRUUHFWHG 6WDLUVDQGZDONLQJVXUIDFHV(YHU\VWDLUUDPSODQG LQJEDOFRQ\SRUFKGHFNRURWKHUZDONLQJVXUIDFHVKDOOEH PDLQWDLQHGLQVRXQGFRQGLWLRQDQGJRRGUHSDLU +DQGUDLOVDQGJXDUGV(YHU\KDQGUDLODQGJXDUGVKDOO EH ILUPO\ IDVWHQHG DQG FDSDEOH RI VXSSRUWLQJ QRUPDOO\ LPSRVHGORDGVDQGVKDOOEHPDLQWDLQHGLQJRRGFRQGLWLRQ ,QWHULRUGRRUV(YHU\LQWHULRUGRRUVKDOOILWUHDVRQDEO\ ZHOOZLWKLQLWVIUDPHDQGVKDOOEHFDSDEOHRIEHLQJRSHQHG DQGFORVHGE\EHLQJSURSHUO\DQGVHFXUHO\DWWDFKHGWRMDPEV KHDGHUV RU WUDFNV DV LQWHQGHG E\ WKH PDQXIDFWXUHU RI WKH DWWDFKPHQWKDUGZDUH 6(&7,21 &20321(176(59,&($%,/,7< *HQHUDO7KHFRPSRQHQWVRIDVWUXFWXUHDQGHTXLSPHQW WKHUHLQVKDOOEHPDLQWDLQHGLQJRRGUHSDLUVWUXFWXUDOO\VRXQG DQGLQDVDQLWDU\FRQGLWLRQ 8QVDIHFRQGLWLRQV:KHUHDQ\RIWKHIROORZLQJ FRQGLWLRQVFDXVHWKHFRPSRQHQWRUV\VWHPWREHEH\RQGLWV OLPLWVWDWHWKHFRPSRQHQWRUV\VWHPVKDOOEHGHWHUPLQHG DVXQVDIHDQGVKDOOEHUHSDLUHGRUUHSODFHGWRFRPSO\ZLWK WKH,QWHUQDWLRQDO%XLOGLQJ&RGHRUWKH,QWHUQDWLRQDO([LVW LQJ%XLOGLQJ&RGHDVUHTXLUHGIRUH[LVWLQJEXLOGLQJV 6RLOVWKDWKDYHEHHQVXEMHFWHGWRDQ\RIWKHIROORZ LQJFRQGLWLRQV &ROODSVHRIIRRWLQJRUIRXQGDWLRQV\VWHP 'DPDJHWRIRRWLQJIRXQGDWLRQFRQFUHWHRU RWKHUVWUXFWXUDOHOHPHQWGXHWRVRLOH[SDQ VLRQ $GYHUVH HIIHFWV WR WKH GHVLJQ VWUHQJWK RI IRRWLQJIRXQGDWLRQFRQFUHWHRURWKHUVWUXF WXUDO HOHPHQW GXH WR D FKHPLFDO UHDFWLRQ IURPWKHVRLO ,QDGHTXDWHVRLODVGHWHUPLQHGE\DJHRWHFK QLFDOLQYHVWLJDWLRQ :KHUHWKHDOORZDEOHEHDULQJFDSDFLW\RIWKH VRLOLVLQGRXEW $GYHUVHHIIHFWVWRWKHIRRWLQJIRXQGDWLRQ FRQFUHWHRURWKHUVWUXFWXUDOHOHPHQWGXHWR WKHJURXQGZDWHUWDEOH &RQFUHWHWKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIRO ORZLQJFRQGLWLRQV 'HWHULRUDWLRQ 8OWLPDWHGHIRUPDWLRQ )UDFWXUHV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( )LVVXUHV 6SDOOLQJ ([SRVHGUHLQIRUFHPHQW 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV $OXPLQXPWKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIRO ORZLQJFRQGLWLRQV 'HWHULRUDWLRQ &RUURVLRQ (ODVWLFGHIRUPDWLRQ 8OWLPDWHGHIRUPDWLRQ 6WUHVVRUVWUDLQFUDFNV -RLQWIDWLJXH 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV 0DVRQU\WKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIRO ORZLQJFRQGLWLRQV 'HWHULRUDWLRQ 8OWLPDWHGHIRUPDWLRQ )UDFWXUHVLQPDVRQU\RUPRUWDUMRLQWV )LVVXUHVLQPDVRQU\RUPRUWDUMRLQWV 6SDOOLQJ ([SRVHGUHLQIRUFHPHQW 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV 6WHHOWKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIROORZLQJ FRQGLWLRQV 'HWHULRUDWLRQ (ODVWLFGHIRUPDWLRQ 8OWLPDWHGHIRUPDWLRQ 0HWDOIDWLJXH 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV :RRGWKDWKDVEHHQVXEMHFWHGWRDQ\RIWKHIROORZ LQJFRQGLWLRQV 8OWLPDWHGHIRUPDWLRQ 'HWHULRUDWLRQ 'DPDJHIURPLQVHFWVURGHQWVDQGRWKHU YHUPLQ )LUHGDPDJHEH\RQGFKDUULQJ 6LJQLILFDQWVSOLWVDQGFKHFNV +RUL]RQWDOVKHDUFUDFNV 9HUWLFDOVKHDUFUDFNV ,QDGHTXDWHVXSSRUW 'HWDFKHGGLVORGJHGRUIDLOLQJFRQQHFWLRQV ([FHVVLYHFXWWLQJDQGQRWFKLQJ ([FHSWLRQV :KHUHVXEVWDQWLDWHGRWKHUZLVHE\DQDSSURYHG PHWKRG 'HPROLWLRQRIXQVDIHFRQGLWLRQVVKDOOEHSHU PLWWHGZKHUHDSSURYHGE\WKHFRGHRIILFLDO 6(&7,21 +$1'5$,/6$1'*8$5'5$,/6 *HQHUDO(YHU\ H[WHULRU DQG LQWHULRU IOLJKW RI VWDLUV KDYLQJPRUHWKDQIRXUULVHUVVKDOOKDYHDKDQGUDLORQRQHVLGH RIWKHVWDLUDQGHYHU\RSHQSRUWLRQRIDVWDLUODQGLQJEDO FRQ\SRUFKGHFNUDPSRURWKHUZDONLQJVXUIDFHWKDWLVPRUH WKDQLQFKHVPPDERYHWKHIORRURUJUDGHEHORZVKDOO KDYHJXDUGV+DQGUDLOVVKDOOEHQRWOHVVWKDQLQFKHV PPLQKHLJKWRUPRUHWKDQLQFKHVPPLQKHLJKW PHDVXUHGYHUWLFDOO\DERYHWKHQRVLQJRIWKHWUHDGRUDERYH WKHILQLVKHGIORRURIWKHODQGLQJRUZDONLQJVXUIDFHV*XDUGV VKDOOEHQRWOHVVWKDQLQFKHVPPLQKHLJKWDERYHWKH IORRURIWKHODQGLQJEDOFRQ\SRUFKGHFNRUUDPSRURWKHU ZDONLQJVXUIDFH ([FHSWLRQ*XDUGVVKDOOQRWEHUHTXLUHGZKHUHH[HPSWHG E\WKHDGRSWHGEXLOGLQJFRGH 6(&7,21 58%%,6+$1'*$5%$*( $FFXPXODWLRQRIUXEELVKRUJDUEDJH([WHULRUSURS HUW\DQGSUHPLVHVDQGWKHLQWHULRURIHYHU\VWUXFWXUHVKDOOEH IUHHIURPDQ\DFFXPXODWLRQRIUXEELVKRUJDUEDJH 'LVSRVDORIUXEELVK(YHU\RFFXSDQWRIDVWUXFWXUH VKDOOGLVSRVHRIDOOUXEELVKLQDFOHDQDQGVDQLWDU\PDQQHUE\ SODFLQJVXFKUXEELVKLQDSSURYHGFRQWDLQHUV 5XEELVKVWRUDJHIDFLOLWLHV7KHRZQHURIHYHU\ RFFXSLHGSUHPLVHVVKDOOVXSSO\DSSURYHGFRYHUHGFRQWDLQ HUVIRUUXEELVKDQGWKHRZQHURIWKHSUHPLVHVVKDOOEH UHVSRQVLEOHIRUWKHUHPRYDORIUXEELVK 5HIULJHUDWRUV5HIULJHUDWRUV DQG VLPLODU HTXLS PHQWQRWLQRSHUDWLRQVKDOOQRWEHGLVFDUGHGDEDQGRQHGRU VWRUHGRQSUHPLVHVZLWKRXWILUVWUHPRYLQJWKHGRRUV 'LVSRVDORIJDUEDJH(YHU\RFFXSDQWRIDVWUXFWXUH VKDOOGLVSRVHRIJDUEDJHLQDFOHDQDQGVDQLWDU\PDQQHUE\ SODFLQJVXFKJDUEDJHLQDQDSSURYHGJDUEDJHGLVSRVDOIDFLOLW\ RUDSSURYHGJDUEDJHFRQWDLQHUV *DUEDJHIDFLOLWLHV7KHRZQHURIHYHU\GZHOOLQJ VKDOOVXSSO\RQHRIWKHIROORZLQJDQDSSURYHGPHFKDQLFDO IRRG ZDVWH JULQGHU LQ HDFKGZHOOLQJ XQLWDQDSSURYHG LQFLQHUDWRUXQLWLQWKHVWUXFWXUHDYDLODEOHWRWKHRFFXSDQWV LQHDFKGZHOOLQJXQLWRUDQDSSURYHGOHDNSURRIFRYHUHG RXWVLGHJDUEDJHFRQWDLQHU &RQWDLQHUV7KHRSHUDWRURIHYHU\HVWDEOLVKPHQW SURGXFLQJJDUEDJHVKDOOSURYLGHDQGDWDOOWLPHVFDXVHWR EHXWLOL]HGDSSURYHGOHDNSURRIFRQWDLQHUVSURYLGHGZLWK FORVHILWWLQJFRYHUVIRUWKHVWRUDJHRIVXFKPDWHULDOVXQWLO UHPRYHGIURPWKHSUHPLVHVIRUGLVSRVDO 6(&7,21 3(67(/,0,1$7,21 ,QIHVWDWLRQ6WUXFWXUHVVKDOOEHNHSWIUHHIURPLQVHFW DQGURGHQWLQIHVWDWLRQ6WUXFWXUHVLQZKLFKLQVHFWVRUURGHQWV DUHIRXQGVKDOOEHSURPSWO\H[WHUPLQDWHGE\DSSURYHGSUR FHVVHVWKDWZLOOQRWEHLQMXULRXVWRKXPDQKHDOWK$IWHUSHVW Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 Page: 28 Number: 1 Author: MPoehlman Subject: Inserted Text Date: 12/23/2019 2:35:46 PM 308.1 Disposal of garbage or rubbish. The City of Richfield reserves the right to utilize the enforcement and notice processes in Section 601 of the Richfield City Code for garbage, yard waste and recyclables preparation, collection and disposal, scavenging and air pollution. *(1(5$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( HOLPLQDWLRQSURSHUSUHFDXWLRQVVKDOOEHWDNHQWRSUHYHQWUHLQ IHVWDWLRQ 2ZQHU7KHRZQHURIDQ\VWUXFWXUHVKDOOEHUHVSRQVL EOHIRUSHVWHOLPLQDWLRQZLWKLQWKHVWUXFWXUHSULRUWRUHQWLQJRU OHDVLQJWKHVWUXFWXUH 6LQJOHRFFXSDQW7KHRFFXSDQWRIDRQHIDPLO\GZHOO LQJ RU RI D VLQJOHWHQDQW QRQUHVLGHQWLDO VWUXFWXUH VKDOO EH UHVSRQVLEOHIRUSHVWHOLPLQDWLRQRQWKHSUHPLVHV 0XOWLSOHRFFXSDQF\7KHRZQHURIDVWUXFWXUHFRQWDLQ LQJ WZR RU PRUHGZHOOLQJ XQLWVD PXOWLSOHRFFXSDQF\D URRPLQJKRXVHRUDQRQUHVLGHQWLDOVWUXFWXUHVKDOOEHUHVSRQVL EOHIRUSHVWHOLPLQDWLRQLQWKHSXEOLFRUVKDUHGDUHDVRIWKH VWUXFWXUHDQGH[WHULRUSURSHUW\,ILQIHVWDWLRQLVFDXVHGE\ IDLOXUHRIDQRFFXSDQWWRSUHYHQWVXFKLQIHVWDWLRQLQWKHDUHD RFFXSLHGWKHRFFXSDQWDQGRZQHUVKDOOEHUHVSRQVLEOHIRU SHVWHOLPLQDWLRQ 2FFXSDQW7KHRFFXSDQW RI DQ\ VWUXFWXUH VKDOO EH UHVSRQVLEOHIRUWKHFRQWLQXHGURGHQWDQGSHVWIUHHFRQGLWLRQ RIWKHVWUXFWXUH ([FHSWLRQ:KHUHWKHLQIHVWDWLRQVDUHFDXVHGE\GHIHFWV LQWKHVWUXFWXUHWKHRZQHUVKDOOEHUHVSRQVLEOHIRUSHVW HOLPLQDWLRQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 /,*+79(17,/$7,21$1'2&&83$1&</,0,7$7,216 User note: About this chapter:Chapter 4 sets forth requirements to establish the minimum environment for occupiable and habitable buildings by establishing the minimum criteria for light and ventilation and identifying occupancy limitations including minimum room width and area, mini- mum ceiling height and restrictions to prevent overcrowding. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPFRQGLWLRQVDQGVWDQGDUGVIRUOLJKWYHQWLODWLRQDQG VSDFHIRURFFXS\LQJDVWUXFWXUH 5HVSRQVLELOLW\7KHRZQHURIWKHVWUXFWXUHVKDOOSUR YLGHDQGPDLQWDLQOLJKWYHQWLODWLRQDQGVSDFHFRQGLWLRQVLQ FRPSOLDQFH ZLWK WKHVH UHTXLUHPHQWV $ SHUVRQ VKDOO QRW RFFXS\ DVRZQHURFFXSDQW RU SHUPLW DQRWKHU SHUVRQ WR RFFXS\DQ\SUHPLVHVWKDWGRQRWFRPSO\ZLWKWKHUHTXLUH PHQWVRIWKLVFKDSWHU $OWHUQDWLYHGHYLFHV,QOLHXRIWKHPHDQVIRUQDWXUDO OLJKW DQGYHQWLODWLRQ KHUHLQ SUHVFULEHG DUWLILFLDO OLJKW RU PHFKDQLFDOYHQWLODWLRQ FRPSO\LQJ ZLWK WKH,QWHUQDWLRQDO %XLOGLQJ&RGHVKDOOEHSHUPLWWHG 6(&7,21 /,*+7 +DELWDEOHVSDFHV(YHU\KDELWDEOHVSDFHVKDOOKDYH QRWOHVVWKDQRQHZLQGRZRIDSSURYHGVL]HIDFLQJGLUHFWO\WR WKHRXWGRRUVRUWRDFRXUW7KHPLQLPXPWRWDOJOD]HGDUHDIRU HYHU\KDELWDEOHVSDFHVKDOOEHSHUFHQWRIWKHIORRUDUHDRI VXFKURRP:KHUHYHUZDOOVRURWKHUSRUWLRQVRIDVWUXFWXUH IDFHDZLQGRZRIDQ\URRPDQGVXFKREVWUXFWLRQVDUHORFDWHG OHVVWKDQIHHWPPIURPWKHZLQGRZDQGH[WHQGWRD OHYHODERYHWKDWRIWKHFHLOLQJRIWKHURRPVXFKZLQGRZVKDOO QRWEHGHHPHGWRIDFHGLUHFWO\WRWKHRXWGRRUVQRUWRDFRXUW DQGVKDOOQRWEHLQFOXGHGDVFRQWULEXWLQJWRWKHUHTXLUHGPLQL PXPWRWDOZLQGRZDUHDIRUWKHURRP ([FHSWLRQ:KHUHQDWXUDOOLJKWIRUURRPVRUVSDFHVZLWK RXWH[WHULRUJOD]LQJDUHDVLVSURYLGHGWKURXJKDQDGMRLQLQJ URRP WKH XQREVWUXFWHG RSHQLQJ WR WKH DGMRLQLQJ URRP VKDOOEHQRWOHVVWKDQSHUFHQWRIWKHIORRUDUHDRIWKHLQWH ULRUURRPRUVSDFHRUQRWOHVVWKDQVTXDUHIHHW PZKLFKHYHULVJUHDWHU7KHH[WHULRUJOD]LQJDUHDVKDOO EHEDVHGRQWKHWRWDOIORRUDUHDEHLQJVHUYHG &RPPRQKDOOVDQGVWDLUZD\V(YHU\FRPPRQKDOO DQGVWDLUZD\LQUHVLGHQWLDORFFXSDQFLHVRWKHUWKDQLQRQH DQGWZRIDPLO\GZHOOLQJVVKDOOEHOLJKWHGDWDOOWLPHVZLWK QRWOHVVWKDQDZDWWVWDQGDUGLQFDQGHVFHQWOLJKWEXOEIRU HDFKVTXDUHIHHWPRIIORRUDUHDRUHTXLYDOHQWLOOX PLQDWLRQSURYLGHGWKDWWKHVSDFLQJEHWZHHQOLJKWVVKDOOQRW EHJUHDWHUWKDQIHHWPP,QRWKHUWKDQUHVLGHQWLDO RFFXSDQFLHVLQWHULRUDQGH[WHULRUPHDQVRIHJUHVVVWDLUZD\V VKDOOEHLOOXPLQDWHGDWDOOWLPHVWKHEXLOGLQJVSDFHVHUYHGE\ WKHPHDQVRIHJUHVVLVRFFXSLHGZLWKQRWOHVVWKDQIRRWFDQ GOHOX[DWIORRUVODQGLQJVDQGWUHDGV 2WKHUVSDFHV2WKHUVSDFHVVKDOOEHSURYLGHGZLWKQDW XUDORUDUWLILFLDOOLJKWVXIILFLHQWWRSHUPLWWKHPDLQWHQDQFHRI VDQLWDU\FRQGLWLRQVDQGWKHVDIHRFFXSDQF\RIWKHVSDFHDQG XWLOL]DWLRQRIWKHDSSOLDQFHVHTXLSPHQWDQGIL[WXUHV 6(&7,21 9(17,/$7,21 +DELWDEOHVSDFHV(YHU\KDELWDEOHVSDFHVKDOOKDYH QRWOHVVWKDQRQHRSHQDEOHZLQGRZ7KHWRWDORSHQDEOHDUHD RIWKHZLQGRZLQHYHU\URRPVKDOOEHHTXDOWRQRWOHVVWKDQ SHUFHQW RI WKH PLQLPXP JOD]HG DUHD UHTXLUHG LQ 6HFWLRQ ([FHSWLRQ:KHUHURRPVDQGVSDFHVZLWKRXWRSHQLQJVWR WKHRXWGRRUVDUHYHQWLODWHGWKURXJKDQDGMRLQLQJURRPWKH XQREVWUXFWHGRSHQLQJWRWKHDGMRLQLQJURRPVKDOOEHQRW OHVVWKDQSHUFHQWRIWKHIORRUDUHDRIWKHLQWHULRUURRPRU VSDFHEXWQRWOHVVWKDQVTXDUHIHHWP7KHYHQWL ODWLRQRSHQLQJVWRWKHRXWGRRUVVKDOOEHEDVHGRQDWRWDO IORRUDUHDEHLQJYHQWLODWHG %DWKURRPVDQGWRLOHWURRPV(YHU\EDWKURRPDQGWRL OHWURRPVKDOOFRPSO\ZLWKWKHYHQWLODWLRQUHTXLUHPHQWVIRU KDELWDEOHVSDFHVDVUHTXLUHGE\6HFWLRQH[FHSWWKDWD ZLQGRZVKDOOQRWEHUHTXLUHGLQVXFKVSDFHVHTXLSSHGZLWKD PHFKDQLFDOYHQWLODWLRQV\VWHP$LUH[KDXVWHGE\DPHFKDQL FDOYHQWLODWLRQV\VWHPIURPDEDWKURRPRUWRLOHWURRPVKDOO GLVFKDUJHWRWKHRXWGRRUVDQGVKDOOQRWEHUHFLUFXODWHG &RRNLQJIDFLOLWLHV8QOHVVDSSURYHGWKURXJKWKHFHUWLI LFDWHRIRFFXSDQF\FRRNLQJVKDOOQRWEHSHUPLWWHGLQDQ\ URRPLQJ XQLW RU GRUPLWRU\ XQLW DQG D FRRNLQJ IDFLOLW\ RU DSSOLDQFHVKDOOQRWEHSHUPLWWHGWREHSUHVHQWLQWKHURRPLQJ XQLWRUGRUPLWRU\XQLW ([FHSWLRQV :KHUHVSHFLILFDOO\DSSURYHGLQZULWLQJE\WKHFRGH RIILFLDO 'HYLFHVVXFKDVFRIIHHSRWVDQGPLFURZDYHRYHQV VKDOOQRWEHFRQVLGHUHGFRRNLQJDSSOLDQFHV 3URFHVVYHQWLODWLRQ:KHUHLQMXULRXVWR[LFLUULWDWLQJ RUQR[LRXVIXPHVJDVHVGXVWVRUPLVWVDUHJHQHUDWHGDORFDO H[KDXVWYHQWLODWLRQV\VWHPVKDOOEHSURYLGHGWRUHPRYHWKH FRQWDPLQDWLQJDJHQWDWWKHVRXUFH$LUVKDOOEHH[KDXVWHGWR WKHH[WHULRUDQGQRWEHUHFLUFXODWHGWRDQ\VSDFH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,QWHUQDWLRQDO 12 Page: 30 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:19:11 AM -05'00' MSBC Number: 2 Author: MPoehlman Date: 12/23/2019 2:36:05 PM /,*+79(17,/$7,21$1'2&&83$1&</,0,7$7,216 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &ORWKHVGU\HUH[KDXVW&ORWKHVGU\HUH[KDXVWV\VWHPV VKDOO EH LQGHSHQGHQW RI DOO RWKHU V\VWHPV DQG VKDOO EH H[KDXVWHGRXWVLGHWKHVWUXFWXUHLQDFFRUGDQFHZLWKWKHPDQX IDFWXUHU¶VLQVWUXFWLRQV ([FHSWLRQ /LVWHG DQGODEHOHG FRQGHQVLQJ GXFWOHVV FORWKHVGU\HUV 6(&7,21 2&&83$1&</,0,7$7,216 3ULYDF\'ZHOOLQJ XQLWV KRWHO XQLWVKRXVHNHHSLQJ XQLWVURRPLQJXQLWVDQGGRUPLWRU\XQLWVVKDOOEHDUUDQJHGWR SURYLGHSULYDF\DQGEHVHSDUDWHIURPRWKHUDGMRLQLQJVSDFHV 0LQLPXPURRPZLGWKV$KDELWDEOHURRPRWKHUWKDQ DNLWFKHQVKDOOEHQRWOHVVWKDQIHHWPPLQDQ\SODQ GLPHQVLRQ.LWFKHQVVKDOOKDYHDPLQLPXPFOHDUSDVVDJHZD\ RIIHHWPPEHWZHHQFRXQWHUIURQWVDQGDSSOLDQFHVRU FRXQWHUIURQWVDQGZDOOV 0LQLPXP FHLOLQJ KHLJKWV+DELWDEOH VSDFHV KDOO ZD\VFRUULGRUVODXQGU\DUHDVEDWKURRPVWRLOHWURRPVDQG KDELWDEOHEDVHPHQWDUHDVVKDOOKDYHDPLQLPXPFOHDUFHLOLQJ KHLJKWRIIHHWPP ([FHSWLRQV ,QRQHDQGWZRIDPLO\GZHOOLQJVEHDPVRUJLUGHUV VSDFHGQRWOHVVWKDQIHHWPPRQFHQWHUDQG SURMHFWLQJQRWJUHDWHUWKDQLQFKHVPPEHORZ WKHUHTXLUHGFHLOLQJKHLJKW %DVHPHQWURRPVLQRQHDQGWZRIDPLO\GZHOOLQJV RFFXSLHGH[FOXVLYHO\IRUODXQGU\VWXG\RUUHFUHDWLRQ SXUSRVHVKDYLQJDPLQLPXPFHLOLQJKHLJKWRIIHHW LQFKHVPPZLWKDPLQLPXPFOHDUKHLJKWRI IHHW LQFKHVPPXQGHU EHDPV JLUGHUV GXFWVDQGVLPLODUREVWUXFWLRQV 5RRPVRFFXSLHGH[FOXVLYHO\IRUVOHHSLQJVWXG\RU VLPLODUSXUSRVHVDQGKDYLQJDVORSHGFHLOLQJRYHUDOO RUSDUWRIWKHURRPZLWKDPLQLPXPFOHDUFHLOLQJ KHLJKWRIIHHWPPRYHUQRWOHVVWKDQRQH WKLUGRIWKHUHTXLUHGPLQLPXPIORRUDUHD,QFDOFX ODWLQJWKHIORRUDUHDRIVXFKURRPVRQO\WKRVHSRU WLRQVRIWKHIORRUDUHDZLWKDPLQLPXPFOHDUFHLOLQJ KHLJKWRIIHHWPPVKDOOEHLQFOXGHG %HGURRPDQGOLYLQJURRPUHTXLUHPHQWV(YHU\EHG URRPDQGOLYLQJURRPVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRI 6HFWLRQVWKURXJK 5RRPDUHD(YHU\OLYLQJURRPVKDOOFRQWDLQQRW OHVVWKDQVTXDUHIHHWPDQGHYHU\EHGURRP VKDOOFRQWDLQ QRW OHVVWKDQVTXDUH IHHW P DQG HYHU\EHGURRPRFFXSLHGE\PRUHWKDQRQHSHUVRQVKDOO FRQWDLQQRWOHVVWKDQVTXDUHIHHWPRIIORRUDUHD IRUHDFKRFFXSDQWWKHUHRI $FFHVVIURPEHGURRPV%HGURRPVVKDOOQRWFRQ VWLWXWHWKHRQO\PHDQVRIDFFHVVWRRWKHUEHGURRPVRUKDE LWDEOH VSDFHV DQG VKDOO QRW VHUYH DVWKH RQO\PHDQV RI HJUHVVIURPRWKHUKDELWDEOHVSDFHV ([FHSWLRQ 8QLWV WKDW FRQWDLQ IHZHU WKDQ WZREHG URRPV :DWHUFORVHWDFFHVVLELOLW\(YHU\EHGURRPVKDOO KDYHDFFHVVWRQRWOHVVWKDQRQHZDWHUFORVHWDQGRQHODYD WRU\ZLWKRXWSDVVLQJWKURXJKDQRWKHUEHGURRP(YHU\EHG URRPLQDGZHOOLQJXQLWVKDOOKDYHDFFHVVWRQRWOHVVWKDQ RQHZDWHUFORVHWDQGODYDWRU\ORFDWHGLQWKHVDPHVWRU\DV WKHEHGURRPRUDQDGMDFHQWVWRU\ 3URKLELWHG RFFXSDQF\ .LWFKHQV DQG QRQKDELW DEOHVSDFHVVKDOOQRWEHXVHGIRUVOHHSLQJSXUSRVHV 2WKHU UHTXLUHPHQWV%HGURRPV VKDOO FRPSO\ ZLWKWKHDSSOLFDEOHSURYLVLRQVRIWKLVFRGHLQFOXGLQJEXW QRW OLPLWHG WR WKH OLJKWYHQWLODWLRQ URRP DUHD FHLOLQJ KHLJKWDQGURRPZLGWKUHTXLUHPHQWVRIWKLVFKDSWHUWKH SOXPELQJ IDFLOLWLHV DQG ZDWHUKHDWLQJ IDFLOLWLHV UHTXLUH PHQWVRI&KDSWHUWKHKHDWLQJIDFLOLWLHVDQGHOHFWULFDO UHFHSWDFOH UHTXLUHPHQWV RI &KDSWHU DQG WKH VPRNH GHWHFWRUDQGHPHUJHQF\HVFDSHUHTXLUHPHQWVRI&KDSWHU 2YHUFURZGLQJ'ZHOOLQJXQLWVVKDOOQRWEHRFFXSLHG E\ PRUH RFFXSDQWV WKDQ SHUPLWWHG E\ WKH PLQLPXP DUHD UHTXLUHPHQWVRI7DEOH 7$%/( 0,1,080$5($5(48,5(0(176 )RU6, VTXDUHIRRW P D 6HH6HFWLRQIRUFRPELQHGOLYLQJURRPGLQLQJURRPVSDFHV E 6HH 6HFWLRQ IRU OLPLWDWLRQV RQ GHWHUPLQLQJ WKH PLQLPXP RFFXSDQF\DUHDIRUVOHHSLQJSXUSRVHV 6OHHSLQJ DUHD 7KH PLQLPXP RFFXSDQF\ DUHD UHTXLUHGE\7DEOHVKDOOQRWEHLQFOXGHGDVDVOHHSLQJ DUHD LQ GHWHUPLQLQJ WKH PLQLPXP RFFXSDQF\ DUHD IRU VOHHSLQJSXUSRVHV6OHHSLQJDUHDVVKDOOFRPSO\ZLWK6HF WLRQ &RPELQHG VSDFHV &RPELQHG OLYLQJ URRP DQG GLQLQJURRPVSDFHVVKDOOFRPSO\ZLWKWKHUHTXLUHPHQWVRI 7DEOHLIWKHWRWDODUHDLVHTXDOWRWKDWUHTXLUHGIRU VHSDUDWHURRPVDQGLIWKHVSDFHLVORFDWHGVRDVWRIXQFWLRQ DVDFRPELQDWLRQOLYLQJURRPGLQLQJURRP (IILFLHQF\XQLW1RWKLQJLQWKLVVHFWLRQVKDOOSURKLELW DQHIILFLHQF\OLYLQJXQLWIURPPHHWLQJWKHIROORZLQJUHTXLUH PHQWV $XQLWRFFXSLHGE\QRWPRUHWKDQRQHRFFXSDQWVKDOO KDYHDPLQLPXPFOHDUIORRUDUHDRIVTXDUHIHHW P$XQLWRFFXSLHGE\QRWPRUHWKDQWZRRFFX SDQWV VKDOO KDYHD PLQLPXPFOHDU IORRUDUHDRI VTXDUHIHHWP$XQLWRFFXSLHGE\WKUHHRFFX SDQWV VKDOO KDYHD PLQLPXPFOHDU IORRUDUHDRI VTXDUH IHHW P 7KHVH UHTXLUHG DUHDV VKDOO EH H[FOXVLYHRIWKHDUHDVUHTXLUHGE\,WHPVDQG 7KHXQLWVKDOOEHSURYLGHGZLWKDNLWFKHQVLQNFRRNLQJ DSSOLDQFH DQG UHIULJHUDWLRQ IDFLOLWLHV HDFK KDYLQJ D PLQLPXPFOHDUZRUNLQJVSDFHRILQFKHVPP 63$&( 0,1,080$5($,1648$5()((7 RFFXSDQWV RFFXSDQWV RUPRUHRFFXSDQWV /LYLQJURRPDE 'LQLQJURRPDE 1R UHTXLUHPHQW %HGURRPV 6KDOOFRPSO\ZLWK6HFWLRQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 /,*+79(17,/$7,21$1'2&&83$1&</,0,7$7,216 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( LQIURQW/LJKWDQGYHQWLODWLRQFRQIRUPLQJWRWKLVFRGH VKDOOEHSURYLGHG 7KHXQLWVKDOOEHSURYLGHGZLWKDVHSDUDWHEDWKURRP FRQWDLQLQJ D ZDWHU FORVHW ODYDWRU\ DQG EDWKWXE RU VKRZHU 7KHPD[LPXPQXPEHURIRFFXSDQWVVKDOOEHWKUHH )RRGSUHSDUDWLRQ6SDFHVWREHRFFXSLHGIRUIRRG SUHSDUDWLRQSXUSRVHVVKDOOFRQWDLQVXLWDEOHVSDFHDQGHTXLS PHQWWRVWRUHSUHSDUHDQGVHUYHIRRGVLQDVDQLWDU\PDQQHU 7KHUHVKDOOEHDGHTXDWHIDFLOLWLHVDQGVHUYLFHVIRUWKHVDQL WDU\GLVSRVDORIIRRGZDVWHVDQGUHIXVHLQFOXGLQJIDFLOLWLHV IRUWHPSRUDU\VWRUDJH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 3/80%,1*)$&,/,7,(6$1'),;785(5(48,5(0(176 User note: About this chapter:Chapter 5 establishes minimum sanitary and clean conditions in occupied buildings by containing requirements for the installation, maintenance and location of plumbing systems and facilities, including the water supply system, water heating appliances, sew- age disposal systems and related plumbing fixtures. Chapter 5 includes requirements for providing potable water to a building and the basic fixtures to effectively utilize and dispose of that water. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPSOXPELQJV\VWHPVIDFLOLWLHVDQGSOXPELQJIL[WXUHV WREHSURYLGHG 5HVSRQVLELOLW\7KHRZQHURIWKHVWUXFWXUHVKDOOSUR YLGHDQGPDLQWDLQVXFKSOXPELQJIDFLOLWLHVDQGSOXPELQJIL[ WXUHVLQFRPSOLDQFHZLWKWKHVHUHTXLUHPHQWV$SHUVRQVKDOO QRWRFFXS\DVRZQHURFFXSDQWRUSHUPLWDQRWKHUSHUVRQWR RFFXS\DQ\VWUXFWXUHRUSUHPLVHVWKDWGRHVQRWFRPSO\ZLWK WKHUHTXLUHPHQWVRIWKLVFKDSWHU 6(&7,21 5(48,5(')$&,/,7,(6 >3@'ZHOOLQJXQLWV(YHU\GZHOOLQJXQLWVKDOOFRQWDLQ LWVRZQEDWKWXERUVKRZHUODYDWRU\ZDWHUFORVHWDQGNLWFKHQ VLQNWKDWVKDOOEHPDLQWDLQHGLQDVDQLWDU\VDIHZRUNLQJFRQ GLWLRQ7KHODYDWRU\VKDOOEHSODFHGLQWKHVDPHURRPDVWKH ZDWHUFORVHWRUORFDWHGLQFORVHSUR[LPLW\WRWKHGRRUOHDGLQJ GLUHFWO\LQWRWKHURRPLQZKLFKVXFKZDWHUFORVHWLVORFDWHG$ NLWFKHQVLQNVKDOOQRWEHXVHGDVDVXEVWLWXWHIRUWKHUHTXLUHG ODYDWRU\ >3@5RRPLQJKRXVHV1RWOHVVWKDQRQHZDWHUFORVHW ODYDWRU\DQGEDWKWXERUVKRZHUVKDOOEHVXSSOLHGIRUHDFKIRXU URRPLQJXQLWV >3@+RWHOV:KHUHSULYDWHZDWHUFORVHWVODYDWRULHVDQG EDWKVDUHQRWSURYLGHGRQHZDWHUFORVHWRQHODYDWRU\DQGRQH EDWKWXERUVKRZHUKDYLQJDFFHVVIURPDSXEOLFKDOOZD\VKDOO EHSURYLGHGIRUHDFKRFFXSDQWV >3@ (PSOR\HHV¶ IDFLOLWLHV 1RW OHVV WKDQ RQH ZDWHU FORVHWRQHODYDWRU\DQGRQHGULQNLQJIDFLOLW\VKDOOEHDYDLO DEOHWRHPSOR\HHV >3@'ULQNLQJIDFLOLWLHV'ULQNLQJIDFLOLWLHVVKDOO EHDGULQNLQJIRXQWDLQZDWHUFRROHUERWWOHGZDWHUFRROHU RU GLVSRVDEOH FXSV QH[W WR D VLQN RU ZDWHU GLVSHQVHU 'ULQNLQJIDFLOLWLHVVKDOOQRWEHORFDWHGLQWRLOHWURRPVRU EDWKURRPV >3@3XEOLFWRLOHWIDFLOLWLHV3XEOLFWRLOHWIDFLOLWLHVVKDOO EHPDLQWDLQHGLQDVDIHVDQLWDU\DQGZRUNLQJFRQGLWLRQLQ DFFRUGDQFHZLWKWKH,QWHUQDWLRQDO3OXPELQJ&RGH([FHSWIRU SHULRGLFPDLQWHQDQFHRUFOHDQLQJSXEOLFDFFHVVDQGXVHVKDOO EHSURYLGHGWRWKHWRLOHWIDFLOLWLHVDWDOOWLPHVGXULQJRFFX SDQF\RIWKHSUHPLVHV 6(&7,21 72,/(752206 >3@3ULYDF\7RLOHWURRPVDQGEDWKURRPVVKDOOSURYLGH SULYDF\DQGVKDOOQRWFRQVWLWXWHWKHRQO\SDVVDJHZD\WRDKDOO RURWKHUVSDFHRUWRWKHH[WHULRU$GRRUDQGLQWHULRUORFNLQJ GHYLFHVKDOOEHSURYLGHGIRUDOOFRPPRQRUVKDUHGEDWKURRPV DQGWRLOHWURRPVLQDPXOWLSOHGZHOOLQJ >3@ /RFDWLRQ7RLOHW URRPVDQGEDWKURRPV VHUYLQJ KRWHOXQLWVURRPLQJXQLWVRUGRUPLWRU\XQLWVRUKRXVHNHHSLQJ XQLWVVKDOOKDYHDFFHVVE\WUDYHUVLQJQRWPRUHWKDQRQHIOLJKW RIVWDLUVDQGVKDOOKDYHDFFHVVIURPDFRPPRQKDOORUSDV VDJHZD\ >3@/RFDWLRQRIHPSOR\HHWRLOHWIDFLOLWLHV7RLOHWIDFLO LWLHVVKDOOKDYHDFFHVVIURPZLWKLQWKHHPSOR\HHV¶ZRUNLQJ DUHD7KHUHTXLUHGWRLOHWIDFLOLWLHVVKDOOEHORFDWHGQRWPRUH WKDQRQHVWRU\DERYHRUEHORZWKHHPSOR\HHV¶ZRUNLQJDUHD DQGWKHSDWKRIWUDYHOWRVXFKIDFLOLWLHVVKDOOQRWH[FHHGDGLV WDQFHRIIHHWP(PSOR\HHIDFLOLWLHVVKDOOHLWKHUEH VHSDUDWHIDFLOLWLHVRUFRPELQHGHPSOR\HHDQGSXEOLFIDFLOLWLHV ([FHSWLRQ)DFLOLWLHVWKDWDUHUHTXLUHGIRUHPSOR\HHVLQ VWRUDJHVWUXFWXUHVRUNLRVNVZKLFKDUHORFDWHGLQDGMDFHQW VWUXFWXUHV XQGHU WKH VDPH RZQHUVKLS OHDVH RU FRQWURO VKDOOQRWH[FHHGDWUDYHOGLVWDQFHRIIHHWPIURP WKHHPSOR\HHV¶UHJXODUZRUNLQJDUHDWRWKHIDFLOLWLHV >3@)ORRUVXUIDFH,QRWKHUWKDQGZHOOLQJXQLWVHYHU\ WRLOHWURRPIORRUVKDOOEHPDLQWDLQHGWREHDVPRRWKKDUG QRQDEVRUEHQWVXUIDFHWRSHUPLWVXFKIORRUWREHHDVLO\NHSWLQ DFOHDQDQGVDQLWDU\FRQGLWLRQ 6(&7,21 3/80%,1*6<67(06$1'),;785(6 >3@ *HQHUDO 3OXPELQJ IL[WXUHV VKDOO EH SURSHUO\ LQVWDOOHGDQGPDLQWDLQHGLQZRUNLQJRUGHUDQGVKDOOEHNHSW IUHHIURPREVWUXFWLRQVOHDNVDQGGHIHFWVDQGEHFDSDEOHRI SHUIRUPLQJWKHIXQFWLRQIRUZKLFKVXFKSOXPELQJIL[WXUHVDUH GHVLJQHG3OXPELQJIL[WXUHVVKDOOEHPDLQWDLQHGLQDVDIH VDQLWDU\DQGIXQFWLRQDOFRQGLWLRQ >3@)L[WXUHFOHDUDQFHV3OXPELQJIL[WXUHVVKDOOKDYH DGHTXDWHFOHDUDQFHVIRUXVDJHDQGFOHDQLQJ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 3/80%,1*)$&,/,7,(6$1'),;785(5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( >3@3OXPELQJV\VWHPKD]DUGV:KHUHLWLVIRXQGWKDW DSOXPELQJV\VWHPLQDVWUXFWXUHFRQVWLWXWHVDKD]DUGWRWKH RFFXSDQWVRUWKHVWUXFWXUHE\UHDVRQRILQDGHTXDWHVHUYLFH LQDGHTXDWH YHQWLQJ FURVV FRQQHFWLRQ EDFNVLSKRQDJH LPSURSHULQVWDOODWLRQGHWHULRUDWLRQRUGDPDJHRUIRUVLPLODU UHDVRQVWKHFRGHRIILFLDOVKDOOUHTXLUHWKHGHIHFWVWREHFRU UHFWHGWRHOLPLQDWHWKHKD]DUG 6(&7,21 :$7(56<67(0 >3@*HQHUDO(YHU\VLQNODYDWRU\EDWKWXERUVKRZHU GULQNLQJIRXQWDLQZDWHUFORVHWRURWKHUSOXPELQJIL[WXUHVKDOO EHSURSHUO\FRQQHFWHGWRHLWKHUDSXEOLFZDWHUV\VWHPRUWRDQ DSSURYHG SULYDWH ZDWHU V\VWHP .LWFKHQ VLQNV ODYDWRULHV ODXQGU\ IDFLOLWLHV EDWKWXEV DQG VKRZHUV VKDOO EH VXSSOLHG ZLWKKRWRUWHPSHUHGDQGFROGUXQQLQJZDWHULQDFFRUGDQFH ZLWKWKH,QWHUQDWLRQDO3OXPELQJ&RGH >3@&RQWDPLQDWLRQ7KHZDWHUVXSSO\VKDOOEHPDLQ WDLQHG IUHH IURP FRQWDPLQDWLRQ DQG DOO ZDWHU LQOHWV IRU SOXPELQJIL[WXUHVVKDOOEHORFDWHGDERYHWKHIORRGOHYHOULP RIWKHIL[WXUH6KDPSRREDVLQIDXFHWVMDQLWRUVLQNIDXFHWVDQG RWKHUKRVHELEVRUIDXFHWVWRZKLFKKRVHVDUHDWWDFKHGDQGOHIW LQSODFHVKDOOEHSURWHFWHGE\DQDSSURYHGDWPRVSKHULFW\SH YDFXXPEUHDNHURUDQDSSURYHGSHUPDQHQWO\DWWDFKHGKRVH FRQQHFWLRQYDFXXPEUHDNHU >3@6XSSO\7KHZDWHUVXSSO\V\VWHPVKDOOEHLQVWDOOHG DQGPDLQWDLQHGWRSURYLGHDVXSSO\RIZDWHUWRSOXPELQJIL[ WXUHVGHYLFHVDQGDSSXUWHQDQFHVLQVXIILFLHQWYROXPHDQGDW SUHVVXUHVDGHTXDWHWRHQDEOHWKHIL[WXUHVWRIXQFWLRQSURSHUO\ VDIHO\DQGIUHHIURPGHIHFWVDQGOHDNV >3@:DWHUKHDWLQJIDFLOLWLHV:DWHUKHDWLQJIDFLOLWLHV VKDOOEHSURSHUO\LQVWDOOHGPDLQWDLQHGDQGFDSDEOHRISURYLG LQJ DQ DGHTXDWH DPRXQW RI ZDWHU WR EH GUDZQ DW HYHU\ UHTXLUHGVLQNODYDWRU\EDWKWXEVKRZHUDQGODXQGU\IDFLOLW\ DWDWHPSHUDWXUHQRWOHVVWKDQ)&$JDVEXUQLQJ ZDWHU KHDWHU VKDOO QRW EH ORFDWHG LQ DQ\EDWKURRPWRLOHW URRPEHGURRPRURWKHURFFXSLHGURRPQRUPDOO\NHSWFORVHG XQOHVV DGHTXDWH FRPEXVWLRQ DLU LV SURYLGHG $QDSSURYHG FRPELQDWLRQWHPSHUDWXUHDQGSUHVVXUHUHOLHIYDOYHDQGUHOLHI YDOYHGLVFKDUJHSLSHVKDOOEHSURSHUO\LQVWDOOHGDQGPDLQ WDLQHGRQZDWHUKHDWHUV >3@ 1RQSRWDEOH ZDWHU UHXVH V\VWHPV 1RQSRWDEOH ZDWHUUHXVHV\VWHPVDQGUDLQZDWHUFROOHFWLRQDQGFRQYH\DQFH V\VWHPVVKDOOEHPDLQWDLQHGLQDVDIHDQGVDQLWDU\FRQGLWLRQ :KHUHVXFKV\VWHPVDUHQRWSURSHUO\PDLQWDLQHGWKHV\VWHPV VKDOOEHUHSDLUHGWRSURYLGHIRUVDIHDQGVDQLWDU\FRQGLWLRQV RUWKHV\VWHPVKDOOEHDEDQGRQHGLQDFFRUGDQFHZLWK6HFWLRQ >3@$EDQGRQPHQWRIV\VWHPV:KHUHDQRQSRWD EOHZDWHUUHXVHV\VWHPRUDUDLQZDWHUFROOHFWLRQDQGGLVWUL EXWLRQV\VWHPLVQRWPDLQWDLQHGRUWKHRZQHUFHDVHVXVHRI WKHV\VWHPWKHV\VWHPVKDOOEHDEDQGRQHGLQDFFRUGDQFH ZLWK6HFWLRQRIWKH,QWHUQDWLRQDO3OXPELQJ&RGH 6(&7,21 6$1,7$5<'5$,1$*(6<67(0 >3@*HQHUDO3OXPELQJIL[WXUHVVKDOOEHSURSHUO\FRQ QHFWHGWRHLWKHUDSXEOLFVHZHUV\VWHPRUWRDQDSSURYHGSUL YDWHVHZDJHGLVSRVDOV\VWHP >3@0DLQWHQDQFH(YHU\SOXPELQJVWDFNYHQWZDVWH DQGVHZHUOLQHVKDOOIXQFWLRQSURSHUO\DQGEHNHSWIUHHIURP REVWUXFWLRQVOHDNVDQGGHIHFWV >3@*UHDVHLQWHUFHSWRUV*UHDVHLQWHUFHSWRUVDQGDXWR PDWLFJUHDVHUHPRYDOGHYLFHVVKDOOEHPDLQWDLQHGLQDFFRU GDQFH ZLWK WKLV FRGH DQG WKH PDQXIDFWXUHU¶V LQVWDOODWLRQ LQVWUXFWLRQV *UHDVH LQWHUFHSWRUV DQG DXWRPDWLF JUHDVH UHPRYDOGHYLFHVVKDOOEHUHJXODUO\VHUYLFHGDQGFOHDQHGWR SUHYHQWWKH GLVFKDUJH RI RLO JUHDVH DQG RWKHU VXEVWDQFHV KDUPIXORUKD]DUGRXVWRWKHEXLOGLQJGUDLQDJHV\VWHPWKH SXEOLFVHZHUWKHSULYDWHVHZDJHGLVSRVDOV\VWHPRUWKHVHZ DJHWUHDWPHQW SODQWRUSURFHVVHV5HFRUGVRIPDLQWHQDQFH FOHDQLQJDQGUHSDLUVVKDOOEHDYDLODEOHIRULQVSHFWLRQE\WKH FRGHRIILFLDO 6(&7,21 67250'5$,1$*( >3@*HQHUDO'UDLQDJHRIURRIVDQGSDYHGDUHDV\DUGV DQGFRXUWVDQGRWKHURSHQDUHDVRQWKHSUHPLVHVVKDOOQRWEH GLVFKDUJHGLQDPDQQHUWKDWFUHDWHVDSXEOLFQXLVDQFH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 User note: About this chapter:Chapter 6 establishes minimum performance requirements for heating, electrical and mechanical facilities serving exist- ing structures, such as heating and air-conditioning equipment, appliances and their supporting systems; water heating equipment, appli- ances and systems; cooking equipment and appliances; ventilation and exhaust equipment; gas and liquid fuel distribution piping and components; fireplaces and solid fuel-burning appliances; chimneys and vents; electrical services; lighting fixtures; electrical receptacle out- lets; electrical distribution system equipment, devices and wiring; and elevators, escalators and dumbwaiters. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPPHFKDQLFDODQGHOHFWULFDOIDFLOLWLHVDQGHTXLSPHQW WREHSURYLGHG 5HVSRQVLELOLW\7KHRZQHURIWKHVWUXFWXUHVKDOOSUR YLGH DQG PDLQWDLQ PHFKDQLFDO DQG HOHFWULFDO IDFLOLWLHV DQG HTXLSPHQWLQFRPSOLDQFHZLWKWKHVHUHTXLUHPHQWV$SHUVRQ VKDOOQRWRFFXS\DVRZQHURFFXSDQWRUSHUPLWDQRWKHUSHUVRQ WRRFFXS\DQ\SUHPLVHV WKDW GRHV QRW FRPSO\ ZLWK WKH UHTXLUHPHQWVRIWKLVFKDSWHU 6(&7,21 +($7,1*)$&,/,7,(6 )DFLOLWLHV UHTXLUHG +HDWLQJ IDFLOLWLHV VKDOO EH SUR YLGHGLQVWUXFWXUHVDVUHTXLUHGE\WKLVVHFWLRQ 5HVLGHQWLDORFFXSDQFLHV'ZHOOLQJVVKDOOEHSURYLGHG ZLWKKHDWLQJIDFLOLWLHVFDSDEOHRIPDLQWDLQLQJDURRPWHP SHUDWXUHRI)&LQDOOKDELWDEOHURRPVEDWKURRPV DQGWRLOHWURRPVEDVHGRQWKHZLQWHURXWGRRUGHVLJQWHPSHUD WXUHIRUWKHORFDOLW\LQGLFDWHGLQ$SSHQGL['RIWKH,QWHUQD WLRQDO3OXPELQJ&RGH&RRNLQJDSSOLDQFHVVKDOOQRWEHXVHG QRU VKDOO SRUWDEOH XQYHQWHG IXHOEXUQLQJ VSDFH KHDWHUV EH XVHGDVDPHDQVWRSURYLGHUHTXLUHGKHDWLQJ ([FHSWLRQ,QDUHDVZKHUHWKHDYHUDJHPRQWKO\WHPSHUD WXUHLVDERYH)&DPLQLPXPWHPSHUDWXUHRI) &VKDOOEHPDLQWDLQHG +HDWVXSSO\(YHU\RZQHUDQGRSHUDWRURIDQ\EXLOG LQJZKRUHQWVOHDVHVRUOHWVRQHRUPRUHGZHOOLQJXQLWVRU VOHHSLQJXQLWVRQWHUPVHLWKHUH[SUHVVHGRULPSOLHGWRIXU QLVKKHDWWRWKHRFFXSDQWVWKHUHRIVKDOOVXSSO\KHDWGXULQJWKH SHULRGIURP>'$7(@WR>'$7(@WRPDLQWDLQDPLQLPXPWHP SHUDWXUHRI)&LQDOOKDELWDEOHURRPVEDWKURRPV DQGWRLOHWURRPV ([FHSWLRQV :KHQWKHRXWGRRUWHPSHUDWXUHLVEHORZWKHZLQWHU RXWGRRUGHVLJQWHPSHUDWXUHIRUWKHORFDOLW\PDLQWH QDQFHRIWKHPLQLPXPURRPWHPSHUDWXUHVKDOOQRW EHUHTXLUHGSURYLGHGWKDWWKHKHDWLQJV\VWHPLVRSHU DWLQJDWLWVIXOOGHVLJQFDSDFLW\7KHZLQWHURXWGRRU GHVLJQWHPSHUDWXUHIRUWKHORFDOLW\VKDOOEHDVLQGL FDWHGLQ$SSHQGL['RIWKH,QWHUQDWLRQDO3OXPELQJ &RGH ,QDUHDVZKHUHWKHDYHUDJHPRQWKO\WHPSHUDWXUHLV DERYH)&DPLQLPXPWHPSHUDWXUHRI) &VKDOOEHPDLQWDLQHG 2FFXSLDEOH ZRUN VSDFHV ,QGRRU RFFXSLDEOH ZRUN VSDFHVVKDOOEHVXSSOLHGZLWKKHDWGXULQJWKHSHULRGIURP >'$7(@WR>'$7(@WRPDLQWDLQDPLQLPXPWHPSHUDWXUHRI) &GXULQJWKHSHULRGWKHVSDFHVDUHRFFXSLHG ([FHSWLRQV 3URFHVVLQJVWRUDJHDQGRSHUDWLRQDUHDVWKDWUHTXLUH FRROLQJRUVSHFLDOWHPSHUDWXUHFRQGLWLRQV $UHDV LQ ZKLFK SHUVRQV DUH SULPDULO\ HQJDJHG LQ YLJRURXVSK\VLFDODFWLYLWLHV 5RRPWHPSHUDWXUHPHDVXUHPHQW7KHUHTXLUHGURRP WHPSHUDWXUHVVKDOOEHPHDVXUHGIHHWPPDERYHWKH IORRUQHDUWKHFHQWHURIWKHURRPDQGIHHWPPLQZDUG IURPWKHFHQWHURIHDFKH[WHULRUZDOO 6(&7,21 0(&+$1,&$/(48,30(17 0HFKDQLFDOHTXLSPHQWDQGDSSOLDQFHV0HFKDQLFDO HTXLSPHQWDSSOLDQFHVILUHSODFHV VROLGIXHOEXUQLQJ DSSOL DQFHVFRRNLQJDSSOLDQFHVDQGZDWHUKHDWLQJDSSOLDQFHVVKDOO EHSURSHUO\LQVWDOOHGDQGPDLQWDLQHGLQDVDIHZRUNLQJFRQGL WLRQDQGVKDOOEHFDSDEOHRISHUIRUPLQJWKHLQWHQGHGIXQF WLRQ 5HPRYDO RI FRPEXVWLRQ SURGXFWV )XHOEXUQLQJ HTXLSPHQWDQGDSSOLDQFHVVKDOOEHFRQQHFWHGWRDQDSSURYHG FKLPQH\RUYHQW ([FHSWLRQ)XHOEXUQLQJHTXLSPHQWDQGDSSOLDQFHVWKDW DUHODEHOHGIRUXQYHQWHGRSHUDWLRQ &OHDUDQFHV5HTXLUHGFOHDUDQFHVWRFRPEXVWLEOHPDWH ULDOVVKDOOEHPDLQWDLQHG 6DIHW\ FRQWUROV 6DIHW\ FRQWUROV IRU IXHOEXUQLQJ HTXLSPHQWVKDOOEHPDLQWDLQHGLQHIIHFWLYHRSHUDWLRQ &RPEXVWLRQDLU$VXSSO\RIDLUIRUFRPSOHWHFRPEXV WLRQRIWKHIXHODQGIRUYHQWLODWLRQRIWKHVSDFHFRQWDLQLQJWKH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 P >'$7(@ WR >'$7(@ >'$7(@ WR >'$7(@ 1 2 Page: 36 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:25:00 AM -05'00' September 15 to May 15 Number: 2 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:24:02 AM -05'00' September 15 to May 15 0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( IXHOEXUQLQJHTXLSPHQWVKDOOEHSURYLGHGIRUWKHIXHOEXUQLQJ HTXLSPHQW (QHUJ\ FRQVHUYDWLRQ GHYLFHV 'HYLFHV LQWHQGHG WR UHGXFH IXHO FRQVXPSWLRQ E\ DWWDFKPHQW WR D IXHOEXUQLQJ DSSOLDQFHWRWKHIXHOVXSSO\OLQHWKHUHWRRUWRWKHYHQWRXWOHW RUYHQWSLSLQJWKHUHIURPVKDOOQRWEHLQVWDOOHGXQOHVVODEHOHG IRUVXFKSXUSRVHDQGWKHLQVWDOODWLRQLVVSHFLILFDOO\DSSURYHG 6(&7,21 (/(&75,&$/)$&,/,7,(6 )DFLOLWLHVUHTXLUHG(YHU\RFFXSLHGEXLOGLQJVKDOOEH SURYLGHGZLWKDQHOHFWULFDOV\VWHPLQFRPSOLDQFHZLWKWKH UHTXLUHPHQWVRIWKLVVHFWLRQDQG6HFWLRQ 6HUYLFH7KHVL]HDQGXVDJHRIDSSOLDQFHVDQGHTXLS PHQWVKDOOVHUYHDVDEDVLVIRUGHWHUPLQLQJWKHQHHGIRUDGGL WLRQDOIDFLOLWLHVLQDFFRUGDQFHZLWK1)3$'ZHOOLQJXQLWV VKDOOEHVHUYHGE\DWKUHHZLUHYROWVLQJOHSKDVH HOHFWULFDOVHUYLFHKDYLQJDPLQLPXPUDWLQJRIDPSHUHV (OHFWULFDOV\VWHPKD]DUGV:KHUHLWLVIRXQGWKDWWKH HOHFWULFDOV\VWHPLQ DVWUXFWXUHFRQVWLWXWHV D KD]DUGWR WKH RFFXSDQWVRUWKHVWUXFWXUHE\UHDVRQRILQDGHTXDWHVHUYLFH LPSURSHUIXVLQJLQVXIILFLHQWUHFHSWDFOHDQGOLJKWLQJRXWOHWV LPSURSHUZLULQJRULQVWDOODWLRQGHWHULRUDWLRQRUGDPDJHRU IRUVLPLODUUHDVRQVWKHFRGHRIILFLDOVKDOOUHTXLUHWKHGHIHFWV WREHFRUUHFWHGWRHOLPLQDWHWKHKD]DUG $EDWHPHQWRIHOHFWULFDOKD]DUGVDVVRFLDWHGZLWK ZDWHUH[SRVXUH7KHSURYLVLRQVRIWKLVVHFWLRQVKDOOJRY HUQWKHUHSDLUDQGUHSODFHPHQWRIHOHFWULFDOV\VWHPVDQG HTXLSPHQWWKDWKDYHEHHQH[SRVHGWRZDWHU (OHFWULFDO HTXLSPHQW (OHFWULFDO GLVWULEX WLRQHTXLSPHQWPRWRUFLUFXLWVSRZHUHTXLSPHQWWUDQV IRUPHUV ZLUH FDEOH IOH[LEOH FRUGV ZLULQJ GHYLFHV JURXQG IDXOW FLUFXLW LQWHUUXSWHUV VXUJH SURWHFWRUV PROGHGFDVHFLUFXLWEUHDNHUVORZYROWDJHIXVHVOXPL QDLUHVEDOODVWVPRWRUVDQGHOHFWURQLFFRQWUROVLJQDOLQJ DQGFRPPXQLFDWLRQHTXLSPHQWWKDWKDYHEHHQH[SRVHG WRZDWHUVKDOOEHUHSODFHGLQDFFRUGDQFHZLWKWKHSURYL VLRQVRIWKH,QWHUQDWLRQDO%XLOGLQJ&RGH ([FHSWLRQ 7KH IROORZLQJ HTXLSPHQW VKDOO EH DOORZHGWREHUHSDLUHGZKHUHDQLQVSHFWLRQUHSRUW IURPWKHHTXLSPHQWPDQXIDFWXUHURUDSSURYHGPDQ XIDFWXUHU¶VUHSUHVHQWDWLYHLQGLFDWHVWKDWWKH HTXLS PHQW KDV QRW VXVWDLQHG GDPDJH WKDW UHTXLUHV UHSODFHPHQW (QFORVHGVZLWFKHVUDWHGQRWPRUHWKDQ YROWVRUOHVV %XVZD\UDWHGQRWPRUHWKDQYROWV 3DQHOERDUGVUDWHGQRWPRUHWKDQYROWV 6ZLWFKERDUGVUDWHGQRWPRUHWKDQYROWV )LUHSXPSFRQWUROOHUVUDWHGQRWPRUHWKDQ YROWV 0DQXDODQGPDJQHWLFPRWRUFRQWUROOHUV 0RWRUFRQWUROFHQWHUV $OWHUQDWLQJ FXUUHQW KLJKYROWDJH FLUFXLW EUHDNHUV /RZYROWDJHSRZHUFLUFXLWEUHDNHUV 3URWHFWLYHUHOD\VPHWHUVDQGFXUUHQWWUDQV IRUPHUV /RZDQGPHGLXPYROWDJHVZLWFKJHDU /LTXLGILOOHGWUDQVIRUPHUV &DVWUHVLQWUDQVIRUPHUV :LUHRUFDEOHWKDWLVVXLWDEOHIRUZHWORFD WLRQVDQGZKRVHHQGVKDYHQRWEHHQH[SRVHG WRZDWHU :LUHRUFDEOHQRWFRQWDLQLQJILOOHUVWKDWLV VXLWDEOH IRU ZHW ORFDWLRQV DQG ZKRVH HQGV KDYHQRWEHHQH[SRVHGWRZDWHU /XPLQDLUHVWKDWDUHOLVWHGDVVXEPHUVLEOH 0RWRUV (OHFWURQLFFRQWUROVLJQDOLQJDQGFRPPXQL FDWLRQHTXLSPHQW $EDWHPHQWRIHOHFWULFDOKD]DUGVDVVRFLDWHGZLWK ILUHH[SRVXUH7KHSURYLVLRQVRIWKLVVHFWLRQVKDOOJRYHUQ WKHUHSDLUDQGUHSODFHPHQWRIHOHFWULFDOV\VWHPVDQGHTXLS PHQWWKDWKDYHEHHQH[SRVHGWRILUH (OHFWULFDO HTXLSPHQW (OHFWULFDO VZLWFKHV UHFHSWDFOHVDQGIL[WXUHVLQFOXGLQJIXUQDFHZDWHUKHDW LQJ VHFXULW\ V\VWHP DQG SRZHU GLVWULEXWLRQ FLUFXLWV WKDW KDYH EHHQ H[SRVHG WR ILUH VKDOO EH UHSODFHG LQ DFFRUGDQFH ZLWK WKH SURYLVLRQV RI WKH,QWHUQDWLRQDO %XLOGLQJ&RGH ([FHSWLRQ(OHFWULFDOVZLWFKHVUHFHSWDFOHVDQGIL[ WXUHVWKDWVKDOOEHDOORZHGWREHUHSDLUHGZKHUHDQ LQVSHFWLRQUHSRUWIURPWKHHTXLSPHQWPDQXIDFWXUHU RUDSSURYHGPDQXIDFWXUHU¶VUHSUHVHQWDWLYHLQGLFDWHV WKDWWKHHTXLSPHQWKDVQRWVXVWDLQHGGDPDJHWKDW UHTXLUHVUHSODFHPHQW 6(&7,21 (/(&75,&$/(48,30(17 ,QVWDOODWLRQ(OHFWULFDOHTXLSPHQWZLULQJDQGDSSOL DQFHVVKDOOEHSURSHUO\LQVWDOOHGDQGPDLQWDLQHGLQDVDIHDQG DSSURYHGPDQQHU 5HFHSWDFOHV(YHU\KDELWDEOHVSDFHLQDGZHOOLQJVKDOO FRQWDLQQRWOHVVWKDQWZRVHSDUDWHDQGUHPRWHUHFHSWDFOHRXW OHWV (YHU\ ODXQGU\ DUHD VKDOO FRQWDLQ QRW OHVV WKDQ RQH JURXQGLQJW\SHUHFHSWDFOHRUDUHFHSWDFOHZLWKDJURXQGIDXOW FLUFXLWLQWHUUXSWHU(YHU\EDWKURRPVKDOOFRQWDLQQRWOHVVWKDQ RQH UHFHSWDFOH $Q\ QHZEDWKURRP UHFHSWDFOH RXWOHW VKDOO KDYHJURXQGIDXOWFLUFXLWLQWHUUXSWHUSURWHFWLRQ$OOUHFHSWDFOH RXWOHWVVKDOOKDYHWKHDSSURSULDWHIDFHSODWHFRYHUIRUWKHORFD WLRQ /XPLQDLUHV(YHU\SXEOLFKDOOLQWHULRUVWDLUZD\WRLOHW URRPNLWFKHQEDWKURRPODXQGU\URRPERLOHUURRPDQGIXU QDFHURRPVKDOOFRQWDLQQRWOHVVWKDQRQHHOHFWULFOXPLQDLUH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,,Q,WHUQDWLRQDO ,QWHUQDWLRQDO %XLOGLQJ &RGH 12 3 Page: 37 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:25:11 AM -05'00' MSBC Number: 2 Author: MPoehlman Date: 12/23/2019 2:38:17 PM Number: 3 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:25:43 AM -05'00' MSBC 0(&+$1,&$/$1'(/(&75,&$/5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 3RRODQGVSDOXPLQDLUHVRYHU9VKDOOKDYHJURXQGIDXOW FLUFXLWLQWHUUXSWHUSURWHFWLRQ :LULQJ)OH[LEOHFRUGVVKDOOQRWEHXVHGIRUSHUPDQHQW ZLULQJRUIRUUXQQLQJWKURXJKGRRUVZLQGRZVRUFDELQHWV RUFRQFHDOHGZLWKLQZDOOVIORRUVRUFHLOLQJV 6(&7,21 (/(9$7256(6&$/$7256$1''80%:$,7(56 *HQHUDO(OHYDWRUVGXPEZDLWHUVDQGHVFDODWRUVVKDOO EHPDLQWDLQHGLQFRPSOLDQFHZLWK$60($7KHPRVW FXUUHQW FHUWLILFDWH RI LQVSHFWLRQ VKDOO EH RQ GLVSOD\ DW DOO WLPHVZLWKLQWKHHOHYDWRURUDWWDFKHGWRWKHHVFDODWRURUGXPE ZDLWHUEHDYDLODEOHIRUSXEOLFLQVSHFWLRQLQWKHRIILFHRIWKH EXLOGLQJRSHUDWRU RU EH SRVWHG LQ D SXEOLFO\ FRQVSLFXRXV ORFDWLRQDSSURYHGE\WKHFRGHRIILFLDO7KHLQVSHFWLRQDQG WHVWVVKDOOEHSHUIRUPHGDWQRWOHVVWKDQWKHSHULRGLFLQWHUYDOV OLVWHGLQ$60($$SSHQGL[1H[FHSWZKHUHRWKHUZLVH VSHFLILHGE\WKHDXWKRULW\KDYLQJMXULVGLFWLRQ (OHYDWRUV,QEXLOGLQJVHTXLSSHGZLWKSDVVHQJHUHOHYD WRUVQRWOHVVWKDQRQHHOHYDWRUVKDOOEHPDLQWDLQHGLQRSHUD WLRQDWDOOWLPHVZKHQWKHEXLOGLQJLVRFFXSLHG ([FHSWLRQ %XLOGLQJV HTXLSSHG ZLWK RQO\ RQH HOHYDWRU VKDOOEHSHUPLWWHGWRKDYHWKHHOHYDWRUWHPSRUDULO\RXWRI VHUYLFHIRUWHVWLQJRUVHUYLFLQJ 6(&7,21 '8&76<67(06 *HQHUDO 'XFW V\VWHPV VKDOO EH PDLQWDLQHG IUHH RI REVWUXFWLRQVDQGVKDOOEHFDSDEOHRISHUIRUPLQJWKHUHTXLUHG IXQFWLRQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 ),5(6$)(7<5(48,5(0(176 User note: About this chapter:Chapter 7 establishes fire safety requirements for existing structures by containing requirements for means of egress, including path of travel, required egress width, means of egress doors and emergency escape openings, and for the maintenance of fire-resis- tance-rated assemblies, fire protection systems, and carbon monoxide alarm and detection systems. 6(&7,21 *(1(5$/ 6FRSH7KHSURYLVLRQVRIWKLVFKDSWHUVKDOOJRYHUQWKH PLQLPXPFRQGLWLRQVDQGVWDQGDUGVIRUILUHVDIHW\UHODWLQJWR VWUXFWXUHVDQGH[WHULRUSUHPLVHVLQFOXGLQJILUHVDIHW\IDFLOL WLHVDQGHTXLSPHQWWREHSURYLGHG 5HVSRQVLELOLW\7KHRZQHURIWKHSUHPLVHVVKDOOSUR YLGHDQGPDLQWDLQVXFKILUHVDIHW\IDFLOLWLHVDQGHTXLSPHQWLQ FRPSOLDQFH ZLWK WKHVH UHTXLUHPHQWV $ SHUVRQ VKDOO QRW RFFXS\ DVRZQHURFFXSDQW RU SHUPLW DQRWKHU SHUVRQ WR RFFXS\DQ\SUHPLVHVWKDWGRQRWFRPSO\ZLWKWKHUHTXLUH PHQWVRIWKLVFKDSWHU 6(&7,21 0($162)(*5(66 >)@*HQHUDO$VDIHFRQWLQXRXVDQGXQREVWUXFWHGSDWK RIWUDYHOVKDOOEHSURYLGHGIURPDQ\SRLQWLQDEXLOGLQJRU VWUXFWXUHWRWKHSXEOLFZD\0HDQVRIHJUHVVVKDOOFRPSO\ ZLWKWKH,QWHUQDWLRQDO)LUH&RGH >)@$LVOHV7KHUHTXLUHGZLGWKRIDLVOHVLQDFFRUGDQFH ZLWKWKH,QWHUQDWLRQDO)LUH&RGHVKDOOEHXQREVWUXFWHG >)@ /RFNHG GRRUV 0HDQV RI HJUHVV GRRUV VKDOO EH UHDGLO\RSHQDEOHIURPWKHVLGHIURPZKLFKHJUHVVLVWREH PDGHZLWKRXWWKHQHHGIRUNH\VVSHFLDONQRZOHGJHRUHIIRUW H[FHSWZKHUHWKHGRRUKDUGZDUHFRQIRUPVWRWKDWSHUPLWWHG E\WKH,QWHUQDWLRQDO%XLOGLQJ&RGH >)@(PHUJHQF\HVFDSHRSHQLQJV5HTXLUHGHPHUJHQF\ HVFDSHRSHQLQJVVKDOOEHPDLQWDLQHGLQDFFRUGDQFHZLWKWKH FRGHLQHIIHFWDWWKHWLPHRIFRQVWUXFWLRQDQGWKHIROORZLQJ 5HTXLUHG HPHUJHQF\ HVFDSH DQG UHVFXH RSHQLQJV VKDOO EH RSHUDWLRQDOIURPWKHLQVLGHRIWKHURRPZLWKRXWWKHXVHRI NH\VRUWRROV%DUVJULOOHVJUDWHVRUVLPLODUGHYLFHVDUHSHU PLWWHGWREHSODFHGRYHUHPHUJHQF\HVFDSHDQGUHVFXHRSHQ LQJV SURYLGHG WKDW WKH PLQLPXP QHW FOHDU RSHQLQJ VL]H FRPSOLHVZLWKWKHFRGHWKDWZDVLQHIIHFWDWWKHWLPHRIFRQ VWUXFWLRQDQGVXFKGHYLFHVVKDOOEHUHOHDVDEOHRUUHPRYDEOH IURPWKHLQVLGHZLWKRXWWKHXVHRIDNH\WRRORUIRUFHJUHDWHU WKDQWKDWZKLFKLVUHTXLUHGIRUQRUPDORSHUDWLRQRIWKHHVFDSH DQGUHVFXHRSHQLQJ 6(&7,21 ),5(5(6,67$1&(5$7,1*6 >)@)LUHUHVLVWDQFHUDWHGDVVHPEOLHV7KHSURYLVLRQV RIWKLVFKDSWHUVKDOOJRYHUQPDLQWHQDQFHRIWKHPDWHULDOVV\V WHPVDQGDVVHPEOLHVXVHGIRUVWUXFWXUDOILUHUHVLVWDQFHDQG ILUHUHVLVWDQFHUDWHG FRQVWUXFWLRQ VHSDUDWLRQ RI DGMDFHQW VSDFHV WR VDIHJXDUG DJDLQVW WKH VSUHDG RI ILUH DQG VPRNH ZLWKLQDEXLOGLQJDQGWKHVSUHDGRIILUHWRRUIURPEXLOGLQJV >)@8QVDIHFRQGLWLRQV:KHUHDQ\FRPSRQHQWVDUHQRW PDLQWDLQHGDQGGRQRWIXQFWLRQDVLQWHQGHGRUGRQRWKDYHWKH ILUHUHVLVWDQFHUHTXLUHGE\WKHFRGHXQGHUZKLFKWKHEXLOGLQJ ZDV FRQVWUXFWHG RU DOWHUHG VXFK FRPSRQHQWV RU SRUWLRQV WKHUHRIVKDOOEHGHHPHGXQVDIHFRQGLWLRQVLQDFFRUGDQFHZLWK 6HFWLRQRIWKH,QWHUQDWLRQDO)LUH&RGH&RPSRQHQWV RUSRUWLRQVWKHUHRIGHWHUPLQHGWREHXQVDIHVKDOOEHUHSDLUHG RUUHSODFHGWRFRQIRUPWRWKDWFRGHXQGHUZKLFKWKHEXLOGLQJ ZDVFRQVWUXFWHGRUDOWHUHG:KHUHWKHFRQGLWLRQRIFRPSR QHQWVLVVXFKWKDWDQ\EXLOGLQJVWUXFWXUHRUSRUWLRQWKHUHRI SUHVHQWVDQLPPLQHQWGDQJHUWRWKHRFFXSDQWVRIWKHEXLOGLQJ VWUXFWXUHRUSRUWLRQWKHUHRIWKHILUHFRGHRIILFLDOVKDOODFWLQ DFFRUGDQFH ZLWK 6HFWLRQ RI WKH,QWHUQDWLRQDO )LUH &RGH >)@0DLQWHQDQFH7KHUHTXLUHGILUHUHVLVWDQFHUDWLQJ RI ILUHUHVLVWDQFHUDWHG FRQVWUXFWLRQ LQFOXGLQJ ZDOOV ILUHVWRSVVKDIWHQFORVXUHVSDUWLWLRQVVPRNHEDUULHUVIORRUV ILUHUHVLVWLYH FRDWLQJV DQG VSUD\HG ILUHUHVLVWDQW PDWHULDOV DSSOLHG WR VWUXFWXUDO PHPEHUV DQG MRLQW V\VWHPV VKDOO EH PDLQWDLQHG6XFKHOHPHQWVVKDOOEHYLVXDOO\LQVSHFWHGDQQX DOO\E\WKHRZQHUDQGUHSDLUHGUHVWRUHGRUUHSODFHGZKHUH GDPDJHGDOWHUHGEUHDFKHGRUSHQHWUDWHG5HFRUGVRILQVSHF WLRQVDQGUHSDLUVVKDOOEHPDLQWDLQHG:KHUHFRQFHDOHGVXFK HOHPHQWVVKDOOQRWEHUHTXLUHGWREHYLVXDOO\LQVSHFWHGE\WKH RZQHU XQOHVV WKH FRQFHDOHG VSDFH LV DFFHVVLEOH E\ WKH UHPRYDORUPRYHPHQWRIDSDQHODFFHVVGRRUFHLOLQJWLOHRU HQWU\WRWKHVSDFH2SHQLQJVPDGHWKHUHLQIRUWKHSDVVDJHRI SLSHVHOHFWULFDOFRQGXLWZLUHV GXFWVDLUWUDQVIHUDQGDQ\ RWKHUUHDVRQVKDOOEHSURWHFWHGZLWKDSSURYHGPHWKRGVFDSD EOH RI UHVLVWLQJ WKH SDVVDJH RI VPRNH DQG ILUH 2SHQLQJV WKURXJKILUHUHVLVWDQFHUDWHGDVVHPEOLHVVKDOOEHSURWHFWHGE\ VHOI RU DXWRPDWLFFORVLQJ GRRUV RI DSSURYHG FRQVWUXFWLRQ PHHWLQJWKHILUHSURWHFWLRQUHTXLUHPHQWVIRUWKHDVVHPEO\ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,QWHUQDWLRQDO %XLOGLQJ &RGH 1 Page: 40 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:25:58 AM -05'00' MSBC ),5(6$)(7<5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( >)@)LUHEORFNLQJDQGGUDIWVWRSSLQJ5HTXLUHG ILUHEORFNLQJDQGGUDIWVWRSSLQJLQFRPEXVWLEOHFRQFHDOHG VSDFHVVKDOOEHPDLQWDLQHGWRSURYLGHFRQWLQXLW\DQGLQWHJ ULW\RIWKHFRQVWUXFWLRQ >)@ 6PRNH EDUULHUV DQG VPRNH SDUWLWLRQV 5HTXLUHG VPRNH EDUULHUV DQG VPRNH SDUWLWLRQV VKDOO EH PDLQWDLQHG WR SUHYHQW WKH SDVVDJH RI VPRNH 2SHQLQJV SURWHFWHG ZLWK DSSURYHG VPRNH EDUULHU GRRUV RU VPRNH GDPSHUVVKDOO EH PDLQWDLQHGLQDFFRUGDQFHZLWK1)3$ >)@)LUHZDOOVILUHEDUULHUVDQGILUHSDUWLWLRQV 5HTXLUHGILUHZDOOVILUHEDUULHUVDQGILUHSDUWLWLRQVVKDOOEH PDLQWDLQHGWRSUHYHQWWKHSDVVDJHRIILUH2SHQLQJVSUR WHFWHGZLWKDSSURYHGGRRUVRUILUHGDPSHUVVKDOOEHPDLQ WDLQHGLQDFFRUGDQFHZLWK1)3$ >)@2SHQLQJSURWHFWLYHV2SHQLQJSURWHFWLYHVVKDOOEH PDLQWDLQHG LQ DQ RSHUDWLYH FRQGLWLRQ LQ DFFRUGDQFH ZLWK 1)3$7KHDSSOLFDWLRQRIILHOGDSSOLHGODEHOVDVVRFLDWHG ZLWKWKHPDLQWHQDQFHRIRSHQLQJSURWHFWLYHVVKDOOIROORZWKH UHTXLUHPHQWVRIWKHDSSURYHGWKLUGSDUW\FHUWLILFDWLRQRUJDQL ]DWLRQDFFUHGLWHGIRUOLVWLQJWKHRSHQLQJSURWHFWLYH)LUHGRRUV DQGVPRNHEDUULHUGRRUVVKDOOQRWEHEORFNHGRUREVWUXFWHGRU RWKHUZLVHPDGHLQRSHUDEOH)XVLEOHOLQNVVKDOOEHUHSODFHG ZKHQHYHUIXVHGRUGDPDJHG)LUHGRRUDVVHPEOLHVVKDOOQRW EHPRGLILHG >)@6LJQV:KHUHUHTXLUHGE\WKHFRGHRIILFLDOD VLJQVKDOOEHSHUPDQHQWO\GLVSOD\HGRQRUQHDUHDFKILUH GRRULQOHWWHUVQRWOHVVWKDQLQFKPPKLJKWRUHDGDV IROORZV )RUGRRUVGHVLJQHGWREHNHSWQRUPDOO\RSHQ),5( '225±'2127%/2&. )RU GRRUV GHVLJQHG WR EH NHSW QRUPDOO\ FORVHG ),5('225±.((3&/26(' >)@+ROGRSHQGHYLFHVDQGFORVHUV+ROGRSHQ GHYLFHVDQGDXWRPDWLFGRRUFORVHUVVKDOOEHPDLQWDLQHG 'XULQJWKHSHULRGWKDWVXFKDGHYLFHLVRXWRIVHUYLFHIRU UHSDLUVWKHGRRULWRSHUDWHVVKDOOUHPDLQLQWKHFORVHGSRVL WLRQ >)@ 'RRU RSHUDWLRQ 6ZLQJLQJ ILUH GRRUV VKDOO FORVHIURPWKHIXOORSHQSRVLWLRQDQGODWFKDXWRPDWLFDOO\ 7KHGRRUFORVHUVKDOOH[HUWHQRXJKIRUFHWRFORVHDQGODWFK WKHGRRUIURPDQ\SDUWLDOO\RSHQSRVLWLRQ >)@&HLOLQJV7KHKDQJLQJDQGGLVSOD\LQJRIVDODEOH JRRGVDQGRWKHUGHFRUDWLYHPDWHULDOVIURPDFRXVWLFDOFHLOLQJ V\VWHPV WKDW DUH SDUW RI D ILUHUHVLVWDQFHUDWHG KRUL]RQWDO DVVHPEO\VKDOOEHSURKLELWHG >)@7HVWLQJ+RUL]RQWDODQGYHUWLFDOVOLGLQJDQGUROOLQJ ILUHGRRUVVKDOOEHLQVSHFWHGDQGWHVWHGDQQXDOO\WRFRQILUP RSHUDWLRQDQGIXOOFORVXUH5HFRUGVRILQVSHFWLRQVDQGWHVWLQJ VKDOOEHPDLQWDLQHG >)@9HUWLFDOVKDIWV,QWHULRUYHUWLFDOVKDIWVLQFOXGLQJ VWDLUZD\VHOHYDWRUKRLVWZD\VDQGVHUYLFHDQGXWLOLW\VKDIWV ZKLFK FRQQHFW WZR RU PRUH VWRULHV RI D EXLOGLQJ VKDOO EH HQFORVHGRUSURWHFWHGDVUHTXLUHGLQ&KDSWHURIWKH,QWHU QDWLRQDO)LUH&RGH1HZIORRURSHQLQJVLQH[LVWLQJEXLOGLQJV VKDOOFRPSO\ZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH >)@2SHQLQJSURWHFWLYHFORVHUV:KHUHRSHQLQJVDUH UHTXLUHGWREHSURWHFWHGRSHQLQJSURWHFWLYHVVKDOOEHPDLQ WDLQHGVHOIFORVLQJRUDXWRPDWLFFORVLQJE\VPRNHGHWHFWLRQ ([LVWLQJ IXVLEOHOLQNW\SH DXWRPDWLF GRRUFORVLQJ GHYLFHV VKDOO EH UHSODFHG LI WKH IXVLEOH OLQN UDWLQJ H[FHHGV ) & 6(&7,21 ),5(3527(&7,216<67(06 >)@,QVSHFWLRQWHVWLQJDQGPDLQWHQDQFH)LUHGHWHF WLRQ DODUP DQG H[WLQJXLVKLQJ V\VWHPV PHFKDQLFDO VPRNH H[KDXVWV\VWHPVDQGVPRNHDQGKHDWYHQWVVKDOOEHPDLQ WDLQHGLQDFFRUGDQFHZLWKWKH,QWHUQDWLRQDO)LUH&RGHLQDQ RSHUDWLYH FRQGLWLRQ DW DOO WLPHV DQG VKDOO EH UHSODFHG RU UHSDLUHGZKHUHGHIHFWLYH >)@,QVWDOODWLRQ)LUHSURWHFWLRQV\VWHPVVKDOOEH PDLQWDLQHG LQ DFFRUGDQFH ZLWK WKH RULJLQDO LQVWDOODWLRQ VWDQGDUGV IRU WKDW V\VWHP 5HTXLUHG V\VWHPV VKDOO EH H[WHQGHGDOWHUHGRUDXJPHQWHGDVQHFHVVDU\WRPDLQWDLQ DQGFRQWLQXHSURWHFWLRQZKHUHWKHEXLOGLQJLVDOWHUHGRU HQODUJHG$OWHUDWLRQVWRILUHSURWHFWLRQV\VWHPVVKDOOEH GRQHLQDFFRUGDQFHZLWKDSSOLFDEOHVWDQGDUGV >)@5HTXLUHGILUHSURWHFWLRQV\VWHPV)LUHSUR WHFWLRQV\VWHPVUHTXLUHGE\WKLVFRGHWKH,QWHUQDWLRQDO )LUH &RGHRUWKH,QWHUQDWLRQDO %XLOGLQJ &RGHVKDOOEH LQVWDOOHG UHSDLUHG RSHUDWHG WHVWHG DQG PDLQWDLQHG LQ DFFRUGDQFHZLWKWKLVFRGH$ILUHSURWHFWLRQV\VWHPIRU ZKLFKDGHVLJQRSWLRQH[FHSWLRQRUUHGXFWLRQWRWKHSURYL VLRQVRIWKLVFRGHWKH,QWHUQDWLRQDO)LUH&RGHRUWKH,QWHU QDWLRQDO %XLOGLQJ &RGH KDV EHHQ JUDQWHG VKDOO EH FRQVLGHUHGWREHDUHTXLUHGV\VWHP >)@)LUHSURWHFWLRQV\VWHPV)LUHSURWHFWLRQV\V WHPVVKDOOEHLQVSHFWHGPDLQWDLQHGDQGWHVWHGLQDFFRU GDQFH ZLWK WKH IROORZLQJ,QWHUQDWLRQDO )LUH &RGH UHTXLUHPHQWV $XWRPDWLFVSULQNOHUV\VWHPVVHH6HFWLRQ $XWRPDWLF ILUHH[WLQJXLVKLQJ V\VWHPV SURWHFWLQJ FRPPHUFLDOFRRNLQJV\VWHPVVHH6HFWLRQ $XWRPDWLFZDWHUPLVWH[WLQJXLVKLQJV\VWHPVVHH 6HFWLRQ &DUERQGLR[LGHH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ &DUERQ PRQR[LGH DODUPV DQG FDUERQ PRQR[LGH GHWHFWLRQV\VWHPVVHH6HFWLRQ &OHDQDJHQW H[WLQJXLVKLQJ V\VWHPV VHH 6HFWLRQ 'U\FKHPLFDOH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ )LUHDODUPDQGILUHGHWHFWLRQV\VWHPVVHH6HFWLRQ )LUHGHSDUWPHQWFRQQHFWLRQVVHH6HFWLRQV DQG )LUHSXPSVVHH6HFWLRQ )RDPH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ +DORQH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 1 Page: 41 Number: 1 Author: MPoehlman Subject: Cross-Out Date: 12/23/2019 2:40:05 PM ),5(6$)(7<5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 6LQJOH DQG PXOWLSOHVWDWLRQ VPRNH DODUPV VHH 6HFWLRQ 6PRNH DQG KHDW YHQWV DQG PHFKDQLFDO VPRNH UHPRYDOV\VWHPVVHH6HFWLRQ 6PRNHFRQWUROV\VWHPVVHH6HFWLRQ :HWFKHPLFDOH[WLQJXLVKLQJV\VWHPVVHH6HFWLRQ >)@ 6WDQGDUGV )LUH SURWHFWLRQ V\VWHPV VKDOO EH LQVSHFWHGWHVWHGDQGPDLQWDLQHGLQDFFRUGDQFHZLWKWKHUHIHU HQFHGVWDQGDUGVOLVWHGLQ7DEOHDQGDVUHTXLUHGLQWKLV VHFWLRQ 7$%/( ),5(3527(&7,216<67(00$,17(1$1&(67$1'$5'6 >)@5HFRUGV5HFRUGVVKDOOEHPDLQWDLQHGRIDOO V\VWHPLQVSHFWLRQVWHVWVDQGPDLQWHQDQFHUHTXLUHGE\WKH UHIHUHQFHGVWDQGDUGV >)@ 5HFRUGV LQIRUPDWLRQ ,QLWLDO UHFRUGV VKDOO LQFOXGHWKHQDPHRIWKHLQVWDOODWLRQFRQWUDFWRUW\SHRI FRPSRQHQWV LQVWDOOHG PDQXIDFWXUHU RI WKH FRPSRQHQWV ORFDWLRQDQGQXPEHU RIFRPSRQHQWVLQVWDOOHG SHUIORRU DQGPDQXIDFWXUHUV¶RSHUDWLRQDQGPDLQWHQDQFHLQVWUXFWLRQ PDQXDOV6XFKUHFRUGVVKDOOEHPDLQWDLQHGIRUWKHOLIHRI WKHLQVWDOODWLRQ >)@6\VWHPVRXWRIVHUYLFH:KHUHDUHTXLUHGILUHSUR WHFWLRQV\VWHPLVRXWRIVHUYLFHWKHILUHGHSDUWPHQWDQGWKH ILUHFRGHRIILFLDOVKDOOEHQRWLILHGLPPHGLDWHO\DQGZKHUH UHTXLUHGE\WKHILUHFRGHRIILFLDOHLWKHUWKHEXLOGLQJVKDOOEH HYDFXDWHGRUDQDSSURYHGILUHZDWFKVKDOOEHSURYLGHGIRUDOO RFFXSDQWVOHIWXQSURWHFWHGE\WKHVKXWGRZQXQWLOWKHILUHSUR WHFWLRQV\VWHPKDVEHHQUHWXUQHGWRVHUYLFH:KHUHXWLOL]HG ILUH ZDWFKHV VKDOO EH SURYLGHG ZLWK QRW OHVV WKDQ RQH DSSURYHGPHDQVIRUQRWLILFDWLRQRIWKHILUHGHSDUWPHQWDQG VKDOOQRWKDYHGXWLHVEH\RQGSHUIRUPLQJFRQVWDQWSDWUROVRI WKHSURWHFWHGSUHPLVHVDQGNHHSLQJZDWFKIRUILUHV$FWLRQV VKDOOEHWDNHQLQDFFRUGDQFHZLWK6HFWLRQRIWKH,QWHUQD WLRQDO)LUH&RGHWREULQJWKHV\VWHPVEDFNLQVHUYLFH >)@(PHUJHQF\LPSDLUPHQWV:KHUHXQSODQQHG LPSDLUPHQWVRIILUHSURWHFWLRQV\VWHPVRFFXUDSSURSULDWH HPHUJHQF\ DFWLRQ VKDOO EH WDNHQ WR PLQLPL]H SRWHQWLDO LQMXU\ DQG GDPDJH 7KH LPSDLUPHQW FRRUGLQDWRU VKDOO LPSOHPHQW WKH VWHSV RXWOLQHG LQ 6HFWLRQ RI WKH ,QWHUQDWLRQDO)LUH&RGH >)@ 5HPRYDO RI RU WDPSHULQJ ZLWK HTXLSPHQW,W VKDOOEHXQODZIXOIRUDQ\SHUVRQWRUHPRYHWDPSHUZLWKRU RWKHUZLVHGLVWXUEDQ\ILUHK\GUDQWILUHGHWHFWLRQDQGDODUP V\VWHP ILUH VXSSUHVVLRQ V\VWHP RU RWKHU ILUH DSSOLDQFH UHTXLUHGE\WKLVFRGHH[FHSWIRUWKHSXUSRVHVRIH[WLQJXLVKLQJ ILUHWUDLQLQJUHFKDUJLQJRUPDNLQJQHFHVVDU\UHSDLUV >)@ 5HPRYDO RI RU WDPSHULQJ ZLWK DSSXUWH QDQFHV /RFNV JDWHV GRRUV EDUULFDGHV FKDLQV HQFOR VXUHVVLJQVWDJVDQGVHDOVWKDWKDYHEHHQLQVWDOOHGE\RUDW WKHGLUHFWLRQRIWKHILUHFRGHRIILFLDOVKDOOQRWEHUHPRYHG XQORFNHGGHVWUR\HGRUWDPSHUHGZLWKLQDQ\PDQQHU >)@ 5HPRYDO RI H[LVWLQJ RFFXSDQWXVH KRVH OLQHV7KHILUHFRGHRIILFLDOLVDXWKRUL]HGWRSHUPLWWKH UHPRYDORIH[LVWLQJRFFXSDQWXVHKRVHOLQHVZKHUHDOORI WKHIROORZLQJDSSO\ 7KHLQVWDOODWLRQLVQRWUHTXLUHGE\WKH,QWHUQDWLRQDO )LUH&RGHRUWKH,QWHUQDWLRQDO%XLOGLQJ&RGH 7KHKRVHOLQHZRXOGQRWEHXWLOL]HGE\WUDLQHGSHU VRQQHORUWKHILUHGHSDUWPHQW 7KHUHPDLQLQJRXWOHWVDUHFRPSDWLEOHZLWKORFDOILUH GHSDUWPHQWILWWLQJV >)@7HUPLQDWLRQRIPRQLWRULQJVHUYLFH)RUILUH DODUPV\VWHPVUHTXLUHGWREHPRQLWRUHGE\WKH,QWHUQD WLRQDO)LUH&RGHQRWLFHVKDOOEHPDGHWRWKHILUHFRGHRIIL FLDOZKHQHYHUDODUPPRQLWRULQJVHUYLFHVDUHWHUPLQDWHG 1RWLFHVKDOOEHPDGHLQZULWLQJE\WKHSURYLGHURIWKH PRQLWRULQJVHUYLFHEHLQJWHUPLQDWHG >)@ )LUH GHSDUWPHQW FRQQHFWLRQ :KHUH WKH ILUH GHSDUWPHQW FRQQHFWLRQ LV QRW YLVLEOH WR DSSURDFKLQJ ILUH DSSDUDWXVWKHILUHGHSDUWPHQWFRQQHFWLRQVKDOOEHLQGLFDWHG E\DQDSSURYHGVLJQPRXQWHGRQWKHVWUHHWIURQWRURQWKHVLGH RIWKHEXLOGLQJ6XFKVLJQVKDOOKDYHWKHOHWWHUV³)'&´QRW OHVVWKDQLQFKHVPPKLJKDQGZRUGVLQOHWWHUVQRWOHVV WKDQLQFKHVPPKLJKRUDQDUURZWRLQGLFDWHWKHORFD WLRQ6XFKVLJQVVKDOOEHVXEMHFWWRWKHDSSURYDORIWKHILUH FRGHRIILFLDO >)@ )LUH GHSDUWPHQW FRQQHFWLRQ DFFHVV5HDG\ DFFHVVWRILUHGHSDUWPHQWFRQQHFWLRQVVKDOOEHPDLQWDLQHGDW DOOWLPHVDQGZLWKRXWREVWUXFWLRQE\IHQFHVEXVKHVWUHHV ZDOOVRUDQ\RWKHUIL[HGRUPRYDEOHREMHFW$FFHVVWRILUH GHSDUWPHQWFRQQHFWLRQVVKDOOEHDSSURYHGE\WKHILUHFKLHI ([FHSWLRQ)HQFHVZKHUHSURYLGHGZLWKDQDFFHVVJDWH HTXLSSHG ZLWK D VLJQ FRPSO\LQJ ZLWK WKH OHJHQG UHTXLUHPHQWVRI6HFWLRQRIWKH,QWHUQDWLRQDO)LUH &RGHDQGDPHDQVRIHPHUJHQF\RSHUDWLRQ7KHJDWH DQG WKH PHDQV RI HPHUJHQF\ RSHUDWLRQ VKDOO EH DSSURYHGE\WKHILUHFKLHIDQGPDLQWDLQHGRSHUDWLRQDO DWDOOWLPHV >)@&OHDUVSDFHDURXQGFRQQHFWLRQV$ZRUNLQJ VSDFHRIQRWOHVVWKDQLQFKHVPPLQZLGWK LQFKHVPPLQGHSWKDQGLQFKHVPPLQ KHLJKWVKDOOEHSURYLGHGDQGPDLQWDLQHGLQIURQWRIDQGWR WKHVLGHVRIZDOOPRXQWHGILUHGHSDUWPHQWFRQQHFWLRQVDQG DURXQGWKHFLUFXPIHUHQFHRIIUHHVWDQGLQJILUHGHSDUWPHQW FRQQHFWLRQV 6<67(0 67$1'$5' 3RUWDEOHILUHH[WLQJXLVKHUV 1)3$ &DUERQGLR[LGHILUHH[WLQJXLVKLQJV\VWHP 1)3$ +DORQILUHH[WLQJXLVKLQJV\VWHPV 1)3$$ 'U\FKHPLFDOH[WLQJXLVKLQJV\VWHPV 1)3$ :HWFKHPLFDOH[WLQJXLVKLQJV\VWHPV 1)3$$ :DWHUEDVHGILUHSURWHFWLRQV\VWHPV 1)3$ )LUHDODUPV\VWHPV 1)3$ 6PRNHDQGKHDWYHQWV 1)3$ :DWHUPLVWV\VWHPV 1)3$ &OHDQDJHQWH[WLQJXLVKLQJV\VWHPV 1)3$ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ),5(6$)(7<5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( >)@6LQJOHDQGPXOWLSOHVWDWLRQVPRNHDODUPV6LQ JOHDQGPXOWLSOHVWDWLRQVPRNHDODUPVVKDOOEHLQVWDOOHGLQ H[LVWLQJ *URXS , DQG 5 RFFXSDQFLHV LQ DFFRUGDQFH ZLWK 6HFWLRQVWKURXJK >)@:KHUHUHTXLUHG([LVWLQJ*URXS,DQG5 RFFXSDQFLHVVKDOOEHSURYLGHGZLWKVLQJOHVWDWLRQVPRNH DODUPV LQ DFFRUGDQFH ZLWK 6HFWLRQV WKURXJK ,QWHUFRQQHFWLRQDQGSRZHUVRXUFHVVKDOOEHLQ DFFRUGDQFHZLWK6HFWLRQVDQG ([FHSWLRQV :KHUHWKHFRGHWKDWZDVLQHIIHFWDWWKHWLPHRI FRQVWUXFWLRQUHTXLUHGVPRNHDODUPVDQGVPRNH DODUPV FRPSO\LQJ ZLWK WKRVH UHTXLUHPHQWV DUH DOUHDG\SURYLGHG :KHUHVPRNHDODUPVKDYHEHHQLQVWDOOHGLQRFFX SDQFLHVDQGGZHOOLQJVWKDWZHUHQRWUHTXLUHGWR KDYHWKHPDWWKHWLPHRIFRQVWUXFWLRQDGGLWLRQDO VPRNHDODUPVVKDOOQRWEHUHTXLUHGSURYLGHGWKDW WKHH[LVWLQJVPRNHDODUPVFRPSO\ZLWKUHTXLUH PHQWVWKDWZHUHLQHIIHFWDWWKHWLPHRILQVWDOOD WLRQ :KHUHVPRNHGHWHFWRUVFRQQHFWHGWRDILUHDODUP V\VWHP KDYH EHHQ LQVWDOOHG DV D VXEVWLWXWH IRU VPRNHDODUPV >)@*URXS56LQJOHRUPXOWLSOHVWDWLRQ VPRNHDODUPVVKDOOEHLQVWDOOHGLQDOORIWKHIROORZLQJ ORFDWLRQVLQ*URXS5 ,QVOHHSLQJDUHDV ,QHYHU\URRPLQWKHSDWKRIWKHPHDQVRIHJUHVV IURPWKHVOHHSLQJDUHDWRWKHGRRUOHDGLQJIURP WKHVOHHSLQJXQLW ,QHDFKVWRU\ZLWKLQWKHVOHHSLQJXQLWLQFOXGLQJ EDVHPHQWV )RUVOHHSLQJ XQLWV ZLWK VSOLW OHYHOV DQG ZLWKRXW DQ LQWHUYHQLQJ GRRU EHWZHHQ WKH DGMDFHQWOHYHOVDVPRNHDODUPLQVWDOOHGRQWKH XSSHUOHYHOVKDOOVXIILFHIRUWKHDGMDFHQWORZHU OHYHOSURYLGHGWKDWWKHORZHUOHYHOLVOHVVWKDQRQH IXOOVWRU\EHORZWKHXSSHUOHYHO >)@*URXSV555DQG,6LQJOH RUPXOWLSOHVWDWLRQVPRNHDODUPVVKDOOEHLQVWDOOHGDQG PDLQWDLQHGLQ*URXSV555DQG,UHJDUGOHVV RIRFFXSDQWORDGDWDOORIWKHIROORZLQJORFDWLRQV 2QWKHFHLOLQJRUZDOORXWVLGHRIHDFKVHSDUDWH VOHHSLQJDUHDLQWKHLPPHGLDWHYLFLQLW\RIEHG URRPV ,QHDFKURRPXVHGIRUVOHHSLQJSXUSRVHV ,QHDFKVWRU\ZLWKLQDGZHOOLQJXQLWLQFOXGLQJ EDVHPHQWV EXW QRW LQFOXGLQJ FUDZO VSDFHV DQG XQLQKDELWDEOH DWWLFV ,QGZHOOLQJVRUGZHOOLQJ XQLWVZLWKVSOLWOHYHOVDQGZLWKRXWDQLQWHUYHQLQJ GRRUEHWZHHQWKHDGMDFHQWOHYHOVDVPRNHDODUP LQVWDOOHGRQWKHXSSHUOHYHOVKDOOVXIILFHIRUWKH DGMDFHQWORZHUOHYHOSURYLGHGWKDWWKHORZHUOHYHO LVOHVVWKDQRQHIXOOVWRU\EHORZWKHXSSHUOHYHO >)@ ,QVWDOODWLRQ QHDU FRRNLQJ DSSOLDQFHV 6PRNHDODUPVVKDOOQRWEHLQVWDOOHGLQWKHIROORZLQJ ORFDWLRQV XQOHVV WKLV ZRXOG SUHYHQW SODFHPHQW RI D VPRNH DODUP LQ D ORFDWLRQ UHTXLUHG E\ 6HFWLRQ RU ,RQL]DWLRQ VPRNH DODUPV VKDOO QRW EH LQVWDOOHG OHVVWKDQIHHWPKRUL]RQWDOO\IURPD SHUPDQHQWO\LQVWDOOHGFRRNLQJDSSOLDQFH ,RQL]DWLRQVPRNHDODUPVZLWKDQDODUPVLOHQFLQJ VZLWFK VKDOO QRW EH LQVWDOOHG OHVV WKDQ IHHW PP KRUL]RQWDOO\ IURP D SHUPDQHQWO\ LQVWDOOHGFRRNLQJDSSOLDQFH 3KRWRHOHFWULFVPRNHDODUPVVKDOOQRWEHLQVWDOOHG OHVVWKDQIHHWPPKRUL]RQWDOO\IURPD SHUPDQHQWO\LQVWDOOHGFRRNLQJDSSOLDQFH >)@ ,QVWDOODWLRQ QHDU EDWKURRPV6PRNH DODUPVVKDOOEHLQVWDOOHGQRWOHVVWKDQIHHWPP KRUL]RQWDOO\IURPWKHGRRURURSHQLQJRIDEDWKURRP WKDWFRQWDLQVDEDWKWXERUVKRZHUXQOHVVWKLVZRXOGSUH YHQWSODFHPHQWRIDVPRNHDODUPUHTXLUHGE\6HFWLRQ RU >)@,QWHUFRQQHFWLRQ:KHUHPRUHWKDQRQHVPRNH DODUP LV UHTXLUHG WR EH LQVWDOOHG ZLWKLQ DQ LQGLYLGXDO GZHOOLQJRUVOHHSLQJXQLWWKHVPRNHDODUPVVKDOOEHLQWHU FRQQHFWHG LQ VXFK D PDQQHU WKDW WKH DFWLYDWLRQ RI RQH DODUPZLOODFWLYDWHDOORIWKHDODUPVLQWKHLQGLYLGXDOXQLW 3K\VLFDO LQWHUFRQQHFWLRQ RI VPRNH DODUPV VKDOO QRW EH UHTXLUHGZKHUHOLVWHGZLUHOHVVDODUPVDUHLQVWDOOHGDQGDOO DODUPV VRXQG XSRQ DFWLYDWLRQ RI RQH DODUP 7KH DODUP VKDOOEHFOHDUO\DXGLEOHLQDOOEHGURRPVRYHUEDFNJURXQG QRLVHOHYHOVZLWKDOOLQWHUYHQLQJGRRUVFORVHG ([FHSWLRQV ,QWHUFRQQHFWLRQLVQRWUHTXLUHGLQEXLOGLQJVWKDW DUH QRW XQGHUJRLQJDOWHUDWLRQV UHSDLUV RU FRQ VWUXFWLRQRIDQ\NLQG 6PRNHDODUPVLQH[LVWLQJDUHDVDUHQRWUHTXLUHG WREHLQWHUFRQQHFWHGZKHUHDOWHUDWLRQVRUUHSDLUV GRQRWUHVXOWLQWKHUHPRYDORILQWHULRUZDOORU FHLOLQJ ILQLVKHV H[SRVLQJ WKH VWUXFWXUH XQOHVV WKHUHLVDQDWWLFFUDZOVSDFHRUEDVHPHQWDYDLO DEOHWKDWFRXOGSURYLGHDFFHVVIRULQWHUFRQQHFWLRQ ZLWKRXWWKHUHPRYDORILQWHULRUILQLVKHV >)@3RZHUVRXUFH6LQJOHVWDWLRQVPRNHDODUPV VKDOOUHFHLYHWKHLUSULPDU\SRZHUIURPWKHEXLOGLQJZLULQJ SURYLGHGWKDWVXFKZLULQJLVVHUYHGIURPDFRPPHUFLDO VRXUFH DQG VKDOO EH HTXLSSHG ZLWK D EDWWHU\ EDFNXS 6PRNHDODUPVZLWKLQWHJUDOVWUREHVWKDWDUHQRWHTXLSSHG ZLWKEDWWHU\EDFNXSVKDOOEHFRQQHFWHGWRDQHPHUJHQF\ HOHFWULFDOV\VWHP6PRNHDODUPVVKDOOHPLWDVLJQDOZKHQ WKHEDWWHULHVDUHORZ:LULQJVKDOOEHSHUPDQHQWDQGZLWK RXWDGLVFRQQHFWLQJVZLWFKRWKHUWKDQDVUHTXLUHGIRURYHU FXUUHQWSURWHFWLRQ ([FHSWLRQV 6PRNHDODUPVDUHSHUPLWWHGWREHVROHO\EDWWHU\ RSHUDWHGLQH[LVWLQJEXLOGLQJVZKHUHFRQVWUXFWLRQ LVQRWWDNLQJSODFH 6PRNHDODUPVDUHSHUPLWWHGWREHVROHO\EDWWHU\ RSHUDWHGLQEXLOGLQJVWKDWDUHQRWVHUYHGIURPD FRPPHUFLDOSRZHUVRXUFH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ),5(6$)(7<5(48,5(0(176 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 6PRNHDODUPVDUHSHUPLWWHGWREHVROHO\EDWWHU\ RSHUDWHGLQH[LVWLQJDUHDVRIEXLOGLQJVXQGHUJR LQJDOWHUDWLRQVRUUHSDLUVWKDWGRQRWUHVXOWLQWKH UHPRYDO RI LQWHULRU ZDOOV RU FHLOLQJ ILQLVKHV H[SRVLQJWKHVWUXFWXUH XQOHVVWKHUHLVDQDWWLF FUDZOVSDFHRUEDVHPHQWDYDLODEOHWKDWFRXOGSUR YLGH DFFHVV IRU EXLOGLQJ ZLULQJ ZLWKRXW WKH UHPRYDORILQWHULRUILQLVKHV >)@ 6PRNH GHWHFWLRQ V\VWHP6PRNHGHWHFWRUV OLVWHGLQDFFRUGDQFHZLWK8/DQGSURYLGHGDVSDUWRI WKH EXLOGLQJ¶V ILUH DODUP V\VWHP VKDOO EH DQ DFFHSWDEOH DOWHUQDWLYHWRVLQJOHDQGPXOWLSOHVWDWLRQVPRNHDODUPV DQGVKDOOFRPSO\ZLWKWKHIROORZLQJ 7KHILUHDODUPV\VWHPVKDOOFRPSO\ZLWKDOODSSOLFD EOHUHTXLUHPHQWVLQ6HFWLRQRIWKH,QWHUQDWLRQDO )LUH&RGH $FWLYDWLRQ RI D VPRNH GHWHFWRU LQ D GZHOOLQJ RU VOHHSLQJXQLWVKDOOLQLWLDWHDODUPQRWLILFDWLRQLQWKH GZHOOLQJRUVOHHSLQJXQLWLQDFFRUGDQFHZLWK6HFWLRQ RIWKH,QWHUQDWLRQDO)LUH&RGH $FWLYDWLRQ RI D VPRNH GHWHFWRU LQ DGZHOOLQJRU VOHHSLQJ XQLW VKDOO QRW DFWLYDWH DODUP QRWLILFDWLRQ DSSOLDQFHVRXWVLGHRIWKHGZHOOLQJRUVOHHSLQJXQLW SURYLGHGWKDWDVXSHUYLVRU\VLJQDOLVJHQHUDWHGDQG PRQLWRUHGLQDFFRUGDQFHZLWK6HFWLRQRIWKH ,QWHUQDWLRQDO)LUH&RGH >)@6LQJOHDQGPXOWLSOHVWDWLRQVPRNHDODUPV6LQ JOHDQGPXOWLSOHVWDWLRQVPRNHDODUPVVKDOOEHWHVWHGDQG PDLQWDLQHG LQ DFFRUGDQFH ZLWK WKH PDQXIDFWXUHU¶V LQVWUXF WLRQV6PRNHDODUPVWKDWGRQRWIXQFWLRQVKDOOEHUHSODFHG 6PRNH DODUPV LQVWDOOHG LQ RQH DQG WZRIDPLO\ GZHOOLQJV VKDOOEHUHSODFHGQRWPRUHWKDQ\HDUVIURPWKHGDWHRI PDQXIDFWXUHPDUNHGRQWKHXQLWRUVKDOOEHUHSODFHGLIWKH GDWHRIPDQXIDFWXUHFDQQRWEHGHWHUPLQHG 6(&7,21 &$5%210212;,'($/$506$1''(7(&7,21 >)@ *HQHUDO &DUERQ PRQR[LGH DODUPV VKDOO EH LQVWDOOHGLQGZHOOLQJVLQDFFRUGDQFHZLWK6HFWLRQRI WKH,QWHUQDWLRQDO)LUH&RGHH[FHSWWKDWDODUPVLQGZHOOLQJV FRYHUHG E\ WKH,QWHUQDWLRQDO 5HVLGHQWLDO &RGH VKDOO EH LQVWDOOHGLQDFFRUGDQFHZLWK6HFWLRQ5RIWKDWFRGH >)@&DUERQPRQR[LGHDODUPVDQGGHWHFWRUV&DUERQ PRQR[LGH DODUPV DQG FDUERQ PRQR[LGH GHWHFWLRQ V\VWHPV VKDOOEHPDLQWDLQHGLQDFFRUGDQFHZLWK1)3$&DUERQ PRQR[LGH DODUPV DQG FDUERQ PRQR[LGH GHWHFWRUV WKDW EHFRPH LQRSHUDEOH RU EHJLQ SURGXFLQJ HQGRIOLIH VLJQDOV VKDOOEHUHSODFHG Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( &+$37(5 5()(5(1&('67$1'$5'6 User note: About this chapter:This code contains numerous references to standards promulgated by other organizations that are used to provide requirements for materials and methods of construction. Chapter 8 contains a comprehensive list of all standards that are referenced in this code. These standards, in essence, are part of this code to the extent of the reference to the standard. This chapter lists the standards that are referenced in various sections of this document. The standards are listed herein by the promulgating agency of the standard, the standard identification, the effective date and title and the section or sections of this document that reference the standard. The application of the referenced standards shall be as specified in Section 102.7. $60($PHULFDQ6RFLHW\RI0HFKDQLFDO(QJLQHHUV 7ZR3DUN$YHQXH 1HZ<RUN1< $60($²&6$%²6DIHW\&RGHIRU(OHYDWRUVDQG(VFDODWRUV $670 $670,QWHUQDWLRQDO %DUU+DUERU'ULYH32%R[& :HVW&RQVKRKRFNHQ3$ )²3HUIRUPDQFH6SHFLILFDWLRQVIRU6DIHW\&RYHUVDQG/DEHOLQJ5HTXLUHPHQWVIRU$OO&RYHUVIRU6ZLPPLQJ3RROV6SDV DQG+RW7XEV ,&&,QWHUQDWLRQDO&RGH&RXQFLO 1HZ-HUVH\$YHQXH1: WK)ORRU :DVKLQJWRQ'& ,%&²,QWHUQDWLRQDO%XLOGLQJ&RGH ,(&&²,QWHUQDWLRQDO(QHUJ\&RQVHUYDWLRQ&RGH ,(%&²,QWHUQDWLRQDO([LVWLQJ%XLOGLQJ&RGH ,)&²,QWHUQDWLRQDO)LUH&RGH ,)*&²,QWHUQDWLRQDO)XHO*DV&RGH ,0&²,QWHUQDWLRQDO0HFKDQLFDO&RGH ,3&²,QWHUQDWLRQDO3OXPELQJ&RGH ,5&²,QWHUQDWLRQDO5HVLGHQWLDO&RGH ,=&²,QWHUQDWLRQDO=RQLQJ&RGH Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 5()(5(1&('67$1'$5'6 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 1)3$1DWLRQDO)LUH3URWHFWLRQ$VVRFLDWLRQ %DWWHU\PDUFK3DUN 4XLQF\0$ ²6WDQGDUGIRU3RUWDEOH)LUH([WLQJXLVKHUV 7DEOH ²6WDQGDUGRQ&DUERQ'LR[LGH([WLQJXLVKLQJ6\VWHPV 7DEOH $²6WDQGDUGRQ+DORQ)LUH([WLQJXLVKLQJ6\VWHPV 7DEOH ²6WDQGDUGIRU'U\&KHPLFDO([WLQJXLVKLQJ6\VWHPV 7DEOH $²6WDQGDUGIRU:HW&KHPLFDO([WLQJXLVKLQJ6\VWHPV 7DEOH ²6WDQGDUGIRUWKH,QVSHFWLRQ7HVWLQJDQG0DLQWHQDQFHRI:DWHU%DVHG)LUH3URWHFWLRQ6\VWHPV 7DEOH ²1DWLRQDO(OHFWULFDO&RGH ²1DWLRQDO)LUH$ODUPDQG6LJQDOLQJ&RGH 7DEOH ²6WDQGDUGIRU)LUH'RRUVDQG2WKHU2SHQLQJ3URWHFWLYHV ²6WDQGDUGIRU6PRNH'RRU$VVHPEOLHVDQG2WKHU2SHQLQJ3URWHFWLYHV ²6WDQGDUGIRU6PRNHDQG+HDW9HQWLQJ 7DEOH ²6WDQGDUGIRUWKH,QVWDOODWLRQRI&DUERQ0RQR[LGH&2'HWHFWLRQDQG:DUQLQJ(TXLSPHQW >)@ ²6WDQGDUGRQ:DWHU0LVW)LUH3URWHFWLRQ6\VWHPV 7DEOH ²6WDQGDUGRQ&OHDQ$JHQW)LUH([WLQJXLVKLQJ6\VWHPV 7DEOH 8/8QGHUZULWHUV/DERUDWRULHV//& 3ILQJVWHQ5RDG 1RUWKEURRN,/ ²6PRNH'HWHFWRUVIRU)LUH$ODUP6\VWHPV Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( $33(1',;$ %2$5',1*67$1'$5' 7KHSURYLVLRQVFRQWDLQHGLQWKLVDSSHQGL[DUHQRWPDQGDWRU\XQOHVVVSHFLILFDOO\UHIHUHQFHGLQWKHDGRSWLQJRUGLQDQFH User note: About this appendix: Appendix A provides minimum specifications for boarding a structure. This can be utilized by a jurisdiction as a set of minimum requirements in order to result in consistent boarding quality. These requirements also provide a reasonable means to eliminate having to approve numerous methods or materials for the boarding and securing of a structure. It is important to note that the provisions of Appendix A are not mandatory unless specifically referenced in the adopting ordinance of the authority having jurisdiction. $ *(1(5$/ $*HQHUDO:LQGRZVDQGGRRUVVKDOOEHERDUGHGLQDQ DSSURYHGPDQQHUWRSUHYHQWHQWU\E\XQDXWKRUL]HGSHUVRQV DQGVKDOOEHSDLQWHGWRFRUUHVSRQGWRWKHFRORURIWKHH[LVWLQJ VWUXFWXUH $ 0$7(5,$/6 $%RDUGLQJVKHHWPDWHULDO%RDUGLQJVKHHWPDWHULDO VKDOOEHPLQLPXPLQFKWKLFNPPZRRGVWUXFWXUDO SDQHOVFRPSO\LQJZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH $ %RDUGLQJ IUDPLQJ PDWHULDO %RDUGLQJ IUDPLQJ PDWHULDOVKDOOEHPLQLPXPQRPLQDOLQFKE\LQFKPP E\PPVROLGVDZQOXPEHUFRPSO\LQJZLWKWKH,QWHUQD WLRQDO%XLOGLQJ&RGH $ %RDUGLQJ IDVWHQHUV %RDUGLQJ IDVWHQHUV VKDOO EH PLQLPXPLQFKGLDPHWHUPPFDUULDJHEROWVRIVXFKD OHQJWKDVUHTXLUHGWRSHQHWUDWHWKHDVVHPEO\DQGDVUHTXLUHG WRDGHTXDWHO\DWWDFKWKHZDVKHUVDQGQXWV:DVKHUVDQGQXWV VKDOOFRPSO\ZLWKWKH,QWHUQDWLRQDO%XLOGLQJ&RGH $ ,167$//$7,21 $ %RDUGLQJ LQVWDOODWLRQ 7KH ERDUGLQJ LQVWDOODWLRQ VKDOOEHLQDFFRUGDQFHZLWK)LJXUHV$DQG$ DQG6HFWLRQV$WKURXJK$ $%RDUGLQJVKHHWPDWHULDO7KHERDUGLQJVKHHWPDWH ULDOVKDOOEHFXWWRILWWKHGRRURUZLQGRZRSHQLQJQHDWO\RU VKDOOEHFXWWRSURYLGHDQHTXDORYHUODSDWWKHSHULPHWHURIWKH GRRURUZLQGRZ $:LQGRZV7KHZLQGRZVKDOOEHRSHQHGWRDOORZWKH FDUULDJHEROWWRSDVVWKURXJKRUWKHZLQGRZVDVKVKDOOEH UHPRYHGDQGVWRUHG7KHLQFKE\LQFKPPE\ PPVWURQJEDFNIUDPLQJPDWHULDOVKDOOEHFXWPLQLPXP LQFKHVPPZLGHUWKDQWKHZLQGRZRSHQLQJDQGVKDOOEH SODFHGRQWKHLQVLGHRIWKHZLQGRZRSHQLQJLQFKHV PPPLQLPXPDERYHWKHERWWRPDQGEHORZWKHWRSRIWKH ZLQGRZ RSHQLQJ 7KH IUDPLQJ DQG ERDUGLQJ VKDOO EH SUH GULOOHG7KHDVVHPEO\VKDOOEHDOLJQHGDQGWKHEROWVZDVKHUV DQGQXWVVKDOOEHLQVWDOOHGDQGVHFXUHG $'RRUZDOOV7KHGRRURSHQLQJVKDOOEHIUDPHGZLWK PLQLPXP LQFK E\ LQFK PP E\ PP IUDPLQJ PDWHULDOVHFXUHGDWWKHHQWLUHSHULPHWHUDQGYHUWLFDOPHPEHUV DWDPD[LPXPRILQFKHVPPRQFHQWHU%ORFNLQJ VKDOODOVREHVHFXUHGDWDPD[LPXPRILQFKHVPP RQFHQWHUYHUWLFDOO\%RDUGLQJVKHHWPDWHULDOVKDOOEHVHFXUHG ZLWKVFUHZVDQGQDLOVDOWHUQDWLQJHYHU\LQFKHVPPRQ FHQWHU $'RRUV'RRUVVKDOOEHVHFXUHGE\WKHVDPHPHWKRGDV IRUZLQGRZVRUGRRURSHQLQJV2QHGRRUWRWKHVWUXFWXUHVKDOO EHDYDLODEOHIRUDXWKRUL]HGHQWU\DQGVKDOOEHVHFXUHGDQG ORFNHGLQDQDSSURYHGPDQQHU $ 5()(5(1&('67$1'$5' ,%&² ,QWHUQDWLRQDO%XLOGLQJ&RGH $ $$ Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,QWHUQDWLRQDO %XLOGLQJ &RGH ,QWHUQD ,QWHUQDWLRQDO %XLOGLQJ &RGH 1 23 4 Page: 48 Number: 1 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:28:03 AM -05'00' MSBC Number: 2 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:28:12 AM -05'00' MSBC Number: 3 Author: MPoehlman Date: 12/23/2019 2:40:32 PM Number: 4 Author: MPoehlman Subject: Replace Date: 7/19/2019 9:29:49 AM -05'00' MSBC $33(1',;$ ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 3/8″ carriage bolts. Bolts shall be long enough to extend from the exterior plywood through the interior plywood and strong backs and fastened from the interior with a nut. 2″ x 4″ strong backs Window frame 2″ x 4″ strong backs ½″ CDX plywood or performance-rated OSB. 3/8″ carriage bolts. Bolts shall be long enough to extend from the exterior plywood through the interior plywood and strong backs and fastened from the interior with a nut. 12″ 6″ ),*85($ %2$5',1*2)'22525:,1'2: ½ INCH CDX PLYWOOD OR PERFORMANCE-RATED OSB SHALL BE SECURED TO HEADER, BSE PLATE, STUDS, STILES, AND EDGE BLOCKING USING ALTERNATE SCREWS AND NAILS AT A MAXIMUM OF 6 INCHES O.C. 2 INCH x 4 INCH HEADER 2 INCH x 4 INCH STILE 2 INCH x 4 INCH BASE PLATE 2 INCH x 4 INCH STUDS SPACED 24 INCHES ON CENTER 2 INCH x 4 INCH EDGE BLOCKING EITHER HORIZONTALLY OR VERTICALLY ALONG EDGE OF EACH SHEET OF PLYWOOD OR OSB. For SI: 1 inch = 25.4 mm. DOOR WALL FRAME ),*85($ %2$5',1*2)'225:$// Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( ,1'(; $ $&&(66 Emergency egress . . . . . . . . . . . . . . . . . . . . . . . . 702 From bedrooms . . . . . . . . . . . . . . . . . . . . . . . 404.4.2 Plumbing fixtures, access for cleaning . . . . . . . .504.2 To public way . . . . . . . . . . . . . . . . . . . . . . . . . . .702.1 Toilet room as passageway . . . . . . . . . . . . . . . .503.1 Water closet . . . . . . . . . . . . . . . . . . . . . . . . . . 404.4.3 $'-$&(17 Privacy (hotel units, rooming units). . . . . . . . . . .404.1 $'0,1,675$7,21 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101.2 $*(176HHDOVR23(5$7252:1(5 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 $,5 Combustion air . . . . . . . . . . . . . . . . . . . . . . . . . .603.5 $,6/(6 Minimum width . . . . . . . . . . . . . . . . . . . . . . . . . .702.2 $/7(5$7,21 Applicability of other codes. . . . . . . . . . . . . . . . .102.3 Inspection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .104.2 Prosecution. . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.3 Unlawful acts . . . . . . . . . . . . . . . . . . . . . . . . . . .106.1 $1&+25 Anchored, definition . . . . . . . . . . . . . . . . . . . . . . . 202 Architectural trim. . . . . . . . . . . . . . . . . . . . . . . . .304.8 Signs, marquees and awnings . . . . . . . . . . . . . .304.9 Unsafe conditions. . . . . . . . . . . . . . . . . . . . . . 304.1.1 $33($/ Application . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.1 Board decision . . . . . . . . . . . . . . . . . . . . . . . . . .111.6 Board of appeals . . . . . . . . . . . . . . . . . . . . . . . .111.2 Court review . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.7 Disqualification . . . . . . . . . . . . . . . . . . . . . . . . 111.2.3 Financial interest . . . . . . . . . . . . . . . . . . . . . . 111.2.3 Hearing, emergency orders . . . . . . . . . . . . . . . .109.6 Membership . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.2 Notice of appeal . . . . . . . . . . . . . . . . . . . . . . . . .111.1 Postponed hearing . . . . . . . . . . . . . . . . . . . . . . .111.5 Records . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .104.6 Right to appeal . . . . . . . . . . . . . . . . . . . . . . . . . .111.1 Vote . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.6 $33/,$1&( Cooking . . . . . . . . . . . . . . . . . . . . . . . . . 403.3, 602.2 Mechanical . . . . . . . . . . . . . . . . . . . . . . . . . . . . .603.1 $33/,&$%,/,7< Application of references . . . . . . . . . . . . . . . . . .102.9 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102.1 Other laws. . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.10 Referenced codes and standards. . . . . . . . . . . 102.7 $33529$/ Alternatives. . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.2 Authority . . . . . . . . . . . . . . . . . . . . . . . . . 104.1, 105.2 Modifications. . . . . . . . . . . . . . . . . . . . . . . . . . . 105.1 Research reports . . . . . . . . . . . . . . . . . . . . . . . 105.6 Used material and equipment. . . . . . . . . . . . . . 105.4 $33529(' Alternative materials, methods and equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.2 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Energy conservation devices . . . . . . . . . . . . . . 603.6 Garbage storage facilities. . . . . . . . . . . . . . . . 308.3.1 Modifications. . . . . . . . . . . . . . . . . . . . . . . . . . . 105.1 Used materials and equipment. . . . . . . . . . . . . 105.4 $57,),&,$/ Lighting of habitable rooms. . . . . . . . . . . . . . . . 401.3 Lighting of other spaces . . . . . . . . . . . . . . . . . . 402.3 $87202%,/( Motor vehicles. . . . . . . . . . . . . . . . . . . . . . . . . . 302.8 $:1,1* Signs, marquees and awnings . . . . . . . . . . . . . 304.9 % %$/&21< Handrails and guardrails. . . . . . . . . . . . . . . . . 304.12 %$6(0(17 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Hatchways . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.16 Windows . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.17 %$7+5220 Common bathrooms . . . . . . . . . . . . . . . . 502.3, 503.1 Hotels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502.3 Lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Locks. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503.1 Outlets required . . . . . . . . . . . . . . . . . . . . . . . . 605.2 Privacy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503.1 Ventilation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403.2 %$7+78% Dwelling units . . . . . . . . . . . . . . . . . . . . . . . . . . 502.1 Rooming houses. . . . . . . . . . . . . . . . . . . . . . . . 502.2 Sewage system. . . . . . . . . . . . . . . . . . . . . . . . . 506.1 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . 505.1 %2$5',1* Boarding standard. . . . . . . . . . . . . . . . . . .Appendix A Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( %2,/(5 Unsafe equipment . . . . . . . . . . . . . . . . . . . . . 108.1.2 & &$3$&,7< Heating facilities. . . . . . . . . . . . . . 602.2, 602.3, 602.4 &$56HH$87202%,/( &$5%210212;,'($/$506$1''(7(&7,21 Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 705.1 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . 705.2 &(,/,1* Basement rooms . . . . . . . . . . . . . . . . . . . . . . . . 404.3 Fire-resistance ratings. . . . . . . . . . . . . . . . . . . . 703.1 Interior surfaces. . . . . . . . . . . . . . . . . . . . . . . . . 305.3 Minimum height . . . . . . . . . . . . . . . . . . . . . . . . . 404.3 Sleeping rooms . . . . . . . . . . . . . . . . . . . . . . . . . 404.3 &+$1*(02',)< Application of other codes . . . . . . . . . . . . . . . . . 102.3 &+,01(< Exterior structure . . . . . . . . . . . . . . . . . . . . . . . 304.11 Flue . . . . . . . . . . . . . . . . . . . . . . . . . . . . 603.2, 603.3 &/($1,1* Access for cleaning . . . . . . . . . . . . . . . . . . . . . . 504.2 Disposal of garbage. . . . . . . . . . . . . . . . . . . . . . 308.3 Disposal of rubbish . . . . . . . . . . . . . . . . . . . . . . 308.2 Interior and exterior sanitation . . . . . . . . . . . . . . 308.1 Interior surfaces. . . . . . . . . . . . . . . . . . . . . . . . . 305.3 Plumbing facilities, maintained . . . . . . . . . . . . . 504.1 Required plumbing facilities. . . . . . . . . . . . . . . . . 502 Responsibility of persons. . . . . . . . . . . . . . . . . . 305.1 Trash containers . . . . . . . . . . . . . . . . . . . . . . 308.3.2 Vacant structures and land . . . . . . . . . . . . . . . . 301.3 &/($5$1&( Heating facilities. . . . . . . . . . . . . . . . . . . . . . . . . 603.3 Plumbing fixtures . . . . . . . . . . . . . . . . . . . . . . . . 504.2 &/26,1* Streets . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 109.3 Vacant structures. . . . . . . . . . . . . . . . . . . . . . . . 108.2 &/27+(6'5<(5 Exhaust . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403.5 &2'(2)),&,$/ Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1 Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Duties. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104 Emergency order . . . . . . . . . . . . . . . . . . . . . . . . . 109 Enforcement authority . . . . . . . . . . . . . . . . . . . . 104.1 Failure to comply with demolition order . . . . . . . 110.3 Identification. . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.3 Inspections. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.2 Liability, relief of personal. . . . . . . . . . . . . . . . . .103.4 Membership of board of appeals . . . . . . . . . . . .111.2 Notice of violation. . . . . . . . . . . . . . . . . . . .104.5, 107 Notices and orders. . . . . . . . . . . . . . . . . . . . . . . . 107 Official records. . . . . . . . . . . . . . . . . . . . . . . . . .104.6 Personal liability. . . . . . . . . . . . . . . . . . . . . . . . .103.4 Placarding . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108.4 Prosecution . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.3 Removal of placard . . . . . . . . . . . . . . . . . . . . 108.4.1 Right of entry . . . . . . . . . . . . . . . . . . . . . . . . . . .104.3 Transfer of ownership . . . . . . . . . . . . . . . . . . . .107.6 Vacant structures. . . . . . . . . . . . . . . . . . . . . . . .108.2 Voting of appeals board. . . . . . . . . . . . . 111.2, 111.6 &20%867,21 Combustion air. . . . . . . . . . . . . . . . . . . . . . . . . .603.5 &20321(176(59,&($%,/,7< Unsafe conditions. . . . . . . . . . . . . . . . . . . . . . 306.1.1 &21'(01$7,21 Closing of vacant structures. . . . . . . . . . . . . . . .108.2 Failure to comply . . . . . . . . . . . . . . . . . . . . . . . .110.3 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108.1 Notices and orders. . . . . . . . . . . . . . . . . 108.2, 108.3 Placarding . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108.4 Removal of placard . . . . . . . . . . . . . . . . . . . . 108.4.1 &21)/,&7 Conflict of interest . . . . . . . . . . . . . . . . . . . . . 111.2.3 Violations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.1 &211(&7,21 Sewage system . . . . . . . . . . . . . . . . . . . . . . . . .506.1 Water heating. . . . . . . . . . . . . . . . . . . . . . . . . . .505.4 Water system. . . . . . . . . . . . . . . . . . . . . . . . . . .505.1 &216758&7,21 Existing structures . . . . . . . . . . . . . . . . . . . . . . .101.2 &217$,1(5 Garbage. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 308.3.2 Rubbish storage. . . . . . . . . . . . . . . . . . . . . . . 308.2.1 &217,18286 Unobstructed egress . . . . . . . . . . . . . . . . . . . . .702.1 &21752/ Rodent control . . . . . . . . . . . . . . . . . . . . 302.5, 304.5 Safety controls . . . . . . . . . . . . . . . . . . . . . . . . . .603.4 Weed . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.4 &22/,1* Cooling towers . . . . . . . . . . . . . . . . . . . . . . . . .304.11 &255,'25 Accumulation of rubbish. . . . . . . . . . . . . . . . . . .308.1 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .402.2 Lighting fixtures . . . . . . . . . . . . . . . . . . . . . . . . .605.3 Obstructions. . . . . . . . . . . . . . . . . . . . . . 702.1, 702.2 Ratings maintained . . . . . . . . . . . . . . . . . . . . . . . 703 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( ' '$03'$031(66 Roofs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.7 Window, door frames . . . . . . . . . . . . . . . . . . . .304.13 '$1*(5286+$=$5'286 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . .108.1 Demolition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Electrical hazards . . . . . . . . . . . . . . . . .604.3, 604.3.1 Existing remedies . . . . . . . . . . . . . . . . . . . . . . . .102.4 Imminent danger. . . . . . . . . . . . . . . . . . . . . . . . . . 202 Unsafe equipment . . . . . . . . . . . . . . . . . . . . . 108.1.2 Unsafe structures or premises . . . . . . . . . . . . 108.1.5 '(&.6 Handrails and guardrails. . . . . . . . . . . . . . . . . .304.12 Maintenance. . . . . . . . . . . . . . . . . . . . . 304.2, 304.10 '(02/,7,21 Existing remedies . . . . . . . . . . . . . . . . . . . . . . . .102.4 Failure to comply . . . . . . . . . . . . . . . . . . . . . . . .110.3 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Order . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .110.2 Salvage materials. . . . . . . . . . . . . . . . . . . . . . . .110.4 '(7(&7256 Smoke . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 704 '(7(5,25$7,21 Components of systems. . . . . . . . . . . . . . . . . 306.1.1 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Exterior structure . . . . . . . . . . . . . . . . . . . . . . 304.1.1 Exterior walls . . . . . . . . . . . . . . . . . . . . . . . . . . .304.6 ',5(&7 Egress . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .702.1 ',6326$/ Disposal of garbage . . . . . . . . . . . . . . . . . . . . . .308.3 Disposal of rubbish. . . . . . . . . . . . . . . . . . . . . . .308.2 '225 Exit doors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .702.3 Fire . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.2 Hardware . . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.15 Insect screens . . . . . . . . . . . . . . . . . . . . . . . . .304.14 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Locks . . . . . . . . . . . . . . . . . . . . . . . . . . 304.15, 702.3 Maintenance. . . . . . . . . . . . . . . . . . . . 304.13, 304.15 Weather tight . . . . . . . . . . . . . . . . . . . . . . . . . .304.13 Window and door frames . . . . . . . . . . . . . . . . .304.13 '250,725<5220,1*+286(+27(/027(/ Locked doors . . . . . . . . . . . . . . . . . . . . . . . . . . .702.3 Privacy . . . . . . . . . . . . . . . . . . . . . . . . . . 503.1, 503.2 '5$)767233,1* Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.1 '5$,1'5$,1$*( Basement hatchways . . . . . . . . . . . . . . . . . . . .304.16 Plumbing connections. . . . . . . . . . . . . . . . . . . . . . 506 Storm drainage . . . . . . . . . . . . . . . . . . . . . . . . . . . 507 '8&7 Exhaust duct. . . . . . . . . . . . . . . . . . . . . . . . . . . 304.9 Duct systems . . . . . . . . . . . . . . . . . . . . . . . . . . . . 607 '867 Process ventilation . . . . . . . . . . . . . . . . . . . . . . 403.4 ':(//,1* Cleanliness . . . . . . . . . . . . . . . . . . . . . . . 305.1, 308.1 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Electrical . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 604.1 Heating facilities . . . . . . . . . . . . . . . . . . . . . . . . . . 602 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . . 502 ( (*5(66 Aisles . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 702.2 Emergency escape. . . . . . . . . . . . . . . . . . . . . . 702.4 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 702.1 Lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402.2 Locked doors . . . . . . . . . . . . . . . . . . . . . . . . . . 702.3 Obstructions prohibited. . . . . . . . . . . . . . . . . . . 702.1 Stairs, porches and railings. . . . . . . . . . . . . . . 304.10, 305.4, 305.5, 307.1 (/(&75,&(/(&75,&$/(48,30(17 Abatement of hazards, fire exposure . . . . . . . 604.3.2 Abatement of hazards, water exposure . . . . . 604.3.1 Condemnation. . . . . . . . . . . . . . . . . . . . . . . . . . 108.1 Electrical equipment . . . . . . . . . . . . . . . . . . 604.3.1.1 Facilities required . . . . . . . . . . . . . . . . . . . . . . . 604.1 Hazards. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 604.3 Installation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.1 Lighting fixtures. . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Receptacles . . . . . . . . . . . . . . . . . . . . . . 604.3, 605.2 Responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . 601.2 Service . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 604.2 (/(9$725(6&$/$7256'80%:$,7(56 Condemnation. . . . . . . . . . . . . . . . . . . . . . . . . . 108.1 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 606.1 Maintenance . . . . . . . . . . . . . . . . . . . . . . 606.1, 606.2 (0(5*(1&< Emergency escape openings . . . . . . . . . . . . . . 702.4 Emergency measures. . . . . . . . . . . . . . . . . . . . . . 109 Emergency orders. . . . . . . . . . . . . . . . . . . . . . . 109.1 (1)25&(0(17 Duties and powers . . . . . . . . . . . . . . . . . . . . . . . . 104 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 (48,30(17 Alternative. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.2 Combustion air . . . . . . . . . . . . . . . . . . . . . . . . . 603.5 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Condemnation . . . . . . . . . . . . . . . . . . . 108.1.2, 108.3 Electrical installation . . . . . . . . . . . . . . . . . . . . . 605.1 Emergency order . . . . . . . . . . . . . . . . . . . . . . . . 109.1 Energy conservation devices. . . . . . . . . . . . . . . 603.6 Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 603.1 Interior structure. . . . . . . . . . . . . . . . . . . . . . . . . 305.1 Placarding . . . . . . . . . . . . . . . . . . . . . . . 108.4, 108.5 Prohibited use . . . . . . . . . . . . . . . . . . . . . . . . . . 108.5 Responsibility. . . . . . . . . . . . . . . . . . . . . . . . . . . 601.2 Safety controls. . . . . . . . . . . . . . . . . . . . . . . . . . 603.4 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 Scope, mechanical and electrical . . . . . . . . . . . 601.1 Support, definition . . . . . . . . . . . . . . . . . . . . . . . . 202 Unsafe . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1.2 Used . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.4 (;+$867 Clothes dryer . . . . . . . . . . . . . . . . . . . . . . . . . . . 403.5 Exhaust ducts . . . . . . . . . . . . . . . . . . . . . . . . . . 304.9 Process ventilation. . . . . . . . . . . . . . . . . . . . . . . 403.4 (;,67,1* Remedies. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.4 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 Structural members . . . . . . . . . . . . . . . 304.1.1, 304.4 Structures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.3 (;7(5,25 Decorative features . . . . . . . . . . . . . . . . . . . . . . 304.8 Exterior structure . . . . . . . . . . . . . . . . . . . . . . . . . 304 Exterior walls . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.6 Painting . . . . . . . . . . . . . . . . . . . . . . . . . 304.2, 304.6 Rodent harborage . . . . . . . . . . . . . . . . . 302.5, 304.5 Sanitation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.1 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.1 Stair . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.10 Street numbers . . . . . . . . . . . . . . . . . . . . . . . . . 304.3 Unsafe conditions . . . . . . . . . . . . . . . . . . . . . 304.1.1 Weather tight . . . . . . . . . . . . . . . . . . . . . . . . . . 304.13 ) )$1 Exhaust vents . . . . . . . . . . . . . . . . . . . . . . . . . . 302.6 )((6(;3(16(6&267 Closing vacant structures . . . . . . . . . . . . . . . . . 108.2 Demolition . . . . . . . . . . . . . . . . . . 110.1, 110.3, 110.4 Extermination. . . . . . . . . . 309.2, 309.3, 309.4, 309.5 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 103.5 Relief from personal liability. . . . . . . . . . . . . . . . 103.4 )(1&( Accessory . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 302.7 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.2 ),5( Blocking Maintenance . . . . . . . . . . . . . . . . . . 703.3.1 ),5('(3$570(17 Connection access. . . . . . . . . . . . . . 704.5.1, 704.5.2 Connections. . . . . . . . . . . . . . . . . . . . . . . . . . . .704.5 ),5(3527(&7,216<67(06 Emergency impairments . . . . . . . . . . . . . . . . 704.3.1 Equipment . . . . . . . . . . . . . . .704.4, 704.4.1, 704.4.2 Inspection. . . . . . . . . . . . . . . . . 704.1, 704.1.3, 704.2 Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . 704.1.1 Maintenance. . . . . . . . . . . . . . . 704.1, 704.1.3, 704.2 Out of service. . . . . . . . . . . . . . . . . . . . . . . . . . .704.3 Records of maintenance . . . . . . . . . . . . . . . . 704.2.1 Required systems . . . . . . . . . . . . . . 704.1.2, 704.2.2 Smoke alarms . . . . . . . . . . . . . . . . . . . . . . . . . .704.6 Smoke detections systems . . . . . . . . . . . . . . 704.6.4 Termination of service . . . . . . . . . . . . . . . . . . 704.4.3 Testing . . . . . . . . . . . . . . . . . . . 704.1, 704.1.3, 704.2 ),5(5(6,67$1&(5$7,1*6 Ceilings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.5 Draft stopping . . . . . . . . . . . . . . . . . . . . . . . . 703.3.1 Fire barriers . . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.3 Fire blocking . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.1 Fire partitions . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.3 Fire walls . . . . . . . . . . . . . . . . . . . . . . . . . . . . 703.3.3 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . .703.3 Opening protective. . . . . . . . . . . . . . . . . . . . . . .703.4 Shafts. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.7 Smoke barriers. . . . . . . . . . . . . . . . . . . . . . . . 703.3.2 Smoke partitions . . . . . . . . . . . . . . . . . . . . . . 703.3.2 Unsafe conditions. . . . . . . . . . . . . . . . . . . . . . . .703.2 )/$00$%/(/,48,' Containers . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1.2 )/225)/225,1* Area for sleeping purposes . . . . . . . . . . . . . . 404.4.1 Fire-resistance ratings . . . . . . . . . . . . . . . . . . . .703.1 Interior surfaces . . . . . . . . . . . . . . . . . . . 305.1, 305.3 Space requirements. . . . . . . . . . . . . . .404.4.1, 404.6 )22'35(3$5$7,21 Cooking equipment . . . . . . . . . . . . . . . . . . . . . .403.3 Sanitary condition. . . . . . . . . . . . . . . . . . 305.1, 404.7 Ventilation . . . . . . . . . . . . . . . . . . . . . . . . . . . . .403.4 )281'$7,21 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . 108.1.1 Foundation walls . . . . . . . . . . . . . . . . . . . . . . . .304.5 Unsafe conditions. . . . . . . . . . . . . . . 304.1.1, 305.1.1 )5$0( Window and door frames. . . . . . . . . . . . . . . . .304.13 * *$6 Energy conservation devices. . . . . . . . . . . . . . .603.6 Exhaust vents. . . . . . . . . . . . . . . . . . . . . . . . . . .302.6 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( */$=,1* Materials. . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.13.1 *5$'( Drainage. . . . . . . . . . . . . . . . . . . . . . . . . . .302.2, 507 *8$5' Anchorage and maintenance . . . . . . . . . . . . . .304.12 Basement windows. . . . . . . . . . . . . . . . . . . . 304.18.2 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 + +$%,7$%/( Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 Minimum ceiling height. . . . . . . . . . . . . . . . . . . .404.3 Minimum room width . . . . . . . . . . . . . . . . . . . . .404.2 Required plumbing facilities . . . . . . . . . . . . . . . . . 502 Residential heating facilities . . . . . . . . . . 602.2, 602.3 Space requirements . . . . . . . . . . . . . . . . . . . . 404.4.1 Ventilation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403 +$1'5$,/6$1'*8$5'5$,/6 Handrails . . . . . . . . . . . . . . . . . .304.12, 305.5, 307.1 Stairs and porches . . . . . . . . . . . . . . . . . . . . . .304.10 +$5':$5( Door hardware . . . . . . . . . . . . . . . . . . . 304.15, 702.3 Openable windows . . . . . . . . . . . . . . . . . . . . 304.13.2 +$=$5'2866HH'$1*(5286+$=$5'286 +($7+($7,1* Energy conservation devices . . . . . . . . . . . . . . .603.6 Fireplaces. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .603.1 Heating . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .603.1 Mechanical equipment . . . . . . . . . . . . . . . . . . . .603.1 Required capabilities . . . . . . . . . . . . . . . . . . . . . . 602 Residential heating. . . . . . . . . . . . . . . . . 602.2, 602.3 Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .602.3 Water heating facilities . . . . . . . . . . . . . . . . . . . .505.4 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 +(,*+7 Minimum ceiling height. . . . . . . . . . . . . . . . . . . .404.3 +276HH+($7+($7,1* +27(/65220,1*+286(6$1''250,725< 81,76027(/6 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Locked doors . . . . . . . . . . . . . . . . . . . . . . . . . . .702.3 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . . 502 Toilet rooms . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503 +286(.((3,1*81,7 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 , ,'(17,),&$7,21 Code official . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.4 ,1)(67$7,21 Condemnation. . . . . . . . . . . . . . . . . . . . . . . . . 108.1.3 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Insect and rodent . . . . . . . . . . . 302.5, 304.14, 309.1 ,16(&76 Infestation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 309.1 Insect screens. . . . . . . . . . . . . . . . . . . . . . . . . 304.14 Pest elimination. . . . . . . . . . . . . . . . . . . . . . . . . . . 309 ,163(&7,216 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.2 Right of entry. . . . . . . . . . . . . . . . . . . . . . . . . . . 104.3 ,163(&725 Identification . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.4 Inspections . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.2 Records. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.6 ,17(17 Code . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.3 ,17(5,25 Interior structure . . . . . . . . . . . . . . . . . . . . . . . . . . 305 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . 305.3 Means of egress . . . . . . . . . . . . . . . . . . . . . . . . . . 702 Sanitation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 305.1 Unsafe conditions . . . . . . . . . . . . . . . . . . . . . . 305.1.1 - -85,6',&7,21 Title. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.1 . .,7&+(1 Electrical outlets required . . . . . . . . . . . . . . . . . 605.2 Minimum width . . . . . . . . . . . . . . . . . . . . . . . . . 404.2 Prohibited use. . . . . . . . . . . . . . . . . . . . . . . . . 404.4.4 Room lighting . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Water heating facilities . . . . . . . . . . . . . . . . . . . 505.4 / /$1',1* Handrails and guards . . . . . . . . . . . . . . . . . . . 304.12, 305.5, 306.1 Maintenance . . . . . . . . . . . . . . . . . . . . . 304.10, 305.4 /$81'5< Room lighting . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( /$9$725< Hotels. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502.3 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . 502 Rooming houses . . . . . . . . . . . . . . . . . . . . . . . . 502.2 Sanitary drainage system . . . . . . . . . . . . . . . . . . 506 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 Water system. . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 /($6(6(//5(17 Heat supplied. . . . . . . . . . . . . . . . . . . . . . . . . . . 602.3 Salvage materials . . . . . . . . . . . . . . . . . . . . . . . 110.4 Transfer of ownership . . . . . . . . . . . . . . . . . . . . 107.6 /,(1 Closing of vacant structures . . . . . . . . . . . . . . . 108.2 Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110.3 Failure to comply . . . . . . . . . . . . . . . . . . . . . . . . 110.3 /,*+7/,*+7,1* Common halls and stairways. . . . . . . . . 402.2, 605.3 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 Habitable rooms. . . . . . . . . . . . . . . . . . . . . . . . . 402.1 Kitchen. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Laundry rooms. . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Luminaires. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Other spaces . . . . . . . . . . . . . . . . . . . . . . . . . . . 402.3 Responsibility. . . . . . . . . . . . . . . . . . . . . . . . . . . 401.2 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 Toilet rooms. . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 /,9,1*5220 Room area. . . . . . . . . . . . . . . . . . . . . . . . . . . 404.4.1 /2$'/2$',1* Elevators, escalators and dumbwaiters. . . . . . . 606.1 Handrails and guardrails . . . . . . . . . . . 304.12, 305.5 Live load . . . . . . . . . . . . . . . . . . . . . . . . 304.4, 305.2 Stairs and porches. . . . . . . . . . . . . . . . 304.10, 305.2 Structural members . . . . . . . . . . . . . . . . 304.4, 305.2 0 0$,17(1$1&( Required . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.2 0$7(5,$/ Alternative . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.2 Salvage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110.4 Used . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.4 0($162)(*5(666HH(*5(66 0(&+$1,&$/ Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 603.1 Responsibility. . . . . . . . . . . . . . . . . . . . . . . . . . . 601.2 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 601.1 Ventilation, general . . . . . . . . . . . . . . . . . . . . . . . 403 Ventilation, toilet rooms . . . . . . . . . . . . . . . . . . . 403.2 0,1,080 Ceiling height. . . . . . . . . . . . . . . . . . . . . . . . . . . 404.3 Room area . . . . . . . . . . . . . . . . . . . . . . . . . . . 404.4.1 Room width . . . . . . . . . . . . . . . . . . . . . . . . . . . .404.2 02',),&$7,21 Approval. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .105.1 027(/6HH+27(/6 027259(+,&/(6 Inoperative . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.8 Painting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.8 1 1$785$/ Lighting. . . . . . . . . . . . . . . . . . . . . . . . . . . .401.3, 402 Ventilation . . . . . . . . . . . . . . . . . . . . . . . . .401.3, 403 127,&(6$1'25'(56 Appeal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .111.1 Form. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107.2 Method of service. . . . . . . . . . . . . . . . . . . . . . . .107.3 Orders . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 107 Owner, responsible person . . . . . . . . . . . . . . . .107.1 Penalties . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107.5 Placarding of structure. . . . . . . . . . . . . . . . . . . .108.4 Transfer of ownership . . . . . . . . . . . . . . . . . . . .107.6 Unauthorized tampering. . . . . . . . . . . . . . . . . . .107.4 Vacating structure . . . . . . . . . . . . . . . . . . . . . . .108.2 12;,286 Process ventilation. . . . . . . . . . . . . . . . . . . . . . .403.4 Weeds . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.4 18,6$1&( Closing of vacant structures. . . . . . . . . . . . . . . .108.2 2 2%6758&7,21 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .402.1 Right of entry . . . . . . . . . . . . . . . . . . . . . . . . . . .104.3 2&&83$1&<6HH86( 23(1$%/( Locked doors . . . . . . . . . . . . . . . . . . . . . . . . . . .702.3 Windows. . . . . . . . . . . . . . . . . . . . . . .304.13.2, 403.1 23(1,1*3527(&7,9(6 Closers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.8 Door operation . . . . . . . . . . . . . . . . . . . . . . . 703.4.3 Hold-open devices . . . . . . . . . . . . . . . . . . . . . 703.4.2 Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . . .703.4 Signs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 703.4.1 Testing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .703.6 23(5$725 Definition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 25'(56HH127,&( 25',1$1&(58/( Applicability . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102 Application for appeal. . . . . . . . . . . . . . . . . . . . .111.1 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 287/(7 Electrical. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .605.2 2:1(5 Closing of vacant structures . . . . . . . . . . . . . . . .108.2 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Demolition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Failure to comply . . . . . . . . . . . . . . . . . . . . . . . .110.3 Insect and rat control . . . . . . . . . .302.5, 309.2, 309.4 Notice . . . . . . . . . . . . . . . . . . . . . . . . . . . 107.1, 108.3 Pest elimination . . . . . . . . . . . . . . . . . . . . . . . . .309.2 Placarding of structure . . . . . . . . . . . . . . . . . . . .108.4 Responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . .301.2 Responsibility, fire safety . . . . . . . . . . . . . . . . . .701.2 Responsibility, light, ventilation. . . . . . . . . . . . . .401.2 Responsibility, mechanical and electrical. . . . . .601.2 Responsibility, plumbing facilities. . . . . . . . . . . .501.2 Right of entry . . . . . . . . . . . . . . . . . . . . . . . . . . .104.3 Rubbish storage . . . . . . . . . . . . . . . . . . . . . . . 308.2.1 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101.2 Transfer of ownership. . . . . . . . . . . . . . . . . . . . .107.6 3 3$66$*(:$< Common hall and stairway . . . . . . . . . . . . . . . . .402.2 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Toilet rooms, direct access. . . . . . . . . . . . . . . . .503.1 3(1$/7< Notices and orders . . . . . . . . . . . . . . . . . . . . . . .107.5 Placarding of structure . . . . . . . . . . . . . . . . . . . .108.4 Prohibited occupancy . . . . . . . . . . . . . . . . . . . . .108.5 Removal of placard. . . . . . . . . . . . . . . . . . . . . 108.4.1 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101.2 Violations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.4 3(67(/,0,1$7,21 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . .108.1 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Insect and rodent control 302.5, 304.5, 304.14, 309.1 Pest elimination . . . . . . . . . . . . . . . . . . . . . . . . .309.1 Responsibility of owner. . . . . . . . . . . . . . 301.2, 309.2 Responsibility of tenant-occupant.309.3, 309.4, 309.5 3/$&$5'3267 Closing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .108.2 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . .108.1 Demolition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Emergency, notice . . . . . . . . . . . . . . . . . . . . . . .109.1 Notice to owner. . . . . . . . . . . . . . . . . . . . 107.1, 108.3 Placarding of structure . . . . . . . . . . . . . . . . . . . .108.4 Prohibited use. . . . . . . . . . . . . . . . . . . . . . . . . . .108.5 Removal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.4.1 3/80%,1* Clean and sanitary . . . . . . . . . . . . . . . . . . . . . . .504.1 Clearance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 504.2 Connections . . . . . . . . . . . . . . . . . . . . . . . . . . . 505.1 Contamination. . . . . . . . . . . . . . . . . . . . . . . . . . 505.2 Employee’s facilities . . . . . . . . . . . . . . . . . . . . . 503.3 Fixtures. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 504.1 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . . 502 Responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . 501.2 Sanitary drainage system . . . . . . . . . . . . . . . . . . . 506 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 501.1 Storm drainage . . . . . . . . . . . . . . . . . . . . . . . . . . . 507 Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505.3 Water heating facilities . . . . . . . . . . . . . . . . . . . 505.4 325&+ Handrails. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.12 Structurally sound. . . . . . . . . . . . . . . . . . . . . . 304.10 3257$%/(7(0325$5< Cooking equipment. . . . . . . . . . . . . . . . . . . . . . 603.1 35(6685( Water supply. . . . . . . . . . . . . . . . . . . . . . . . . . . 505.3 35,9$7(35,9$&< Bathtub or shower. . . . . . . . . . . . . . . . . . . . . . . 503.1 Occupancy limitations. . . . . . . . . . . . . . . . . . . . 404.1 Required plumbing facilities . . . . . . . . . . . . . . . . . 502 Sewage system. . . . . . . . . . . . . . . . . . . . . . . . . 506.1 Water closet and lavatory . . . . . . . . . . . . . . . . . 503.1 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . 505.1 3523(57<35(0,6(6 Cleanliness . . . . . . . . . . . . . . . . . . . . . . . 304.1, 308.1 Condemnation. . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Demolition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Emergency measures. . . . . . . . . . . . . . . . . . . . . . 109 Exterior areas . . . . . . . . . . . . . . . . . . . . . . . . . . . . 302 Failure to comply. . . . . . . . . . . . . . . . . . . . . . . . 110.3 Grading and drainage. . . . . . . . . . . . . . . . . . . . 302.2 Pest elimination, multiple occupancy . . . 302.5, 309.4 Pest elimination, single occupancy. . . . . 302.5, 309.3 Responsibility . . . . . . . . . . . . . . . . . . . . . . . . . . 301.2 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.1 Storm drainage . . . . . . . . . . . . . . . . . . . . . . . . . . . 507 Vacant structures and land. . . . . . . . . . . . . . . . 301.3 3527(&7,21 Basement windows. . . . . . . . . . . . . . . . . . . . . 304.17 Fire protection systems. . . . . . . . . . . . . . . . . . . . . 704 Signs, marquees and awnings . . . . . . . . . . . . . 304.9 38%/,& Cleanliness . . . . . . . . . . . . . . . . . . . . . . . 304.1, 305.1 Egress. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 702.1 Hallway . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 502.3 Sewage system. . . . . . . . . . . . . . . . . . . . . . . . . 506.1 Toilet facilities . . . . . . . . . . . . . . . . . . . . . . 502.5, 503 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Vacant structures and land . . . . . . . . . . . . . . . . 301.3 Water system. . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 38%/,&:$< Definition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 5 5$,135(9(17,212)(175<,172%8,/',1* (;7(5,25(19(/23( Basement hatchways. . . . . . . . . . . . . . . . . . . . 304.16 Exterior walls . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.6 Grading and drainage . . . . . . . . . . . . . . . . . . . . 302.2 Roofs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.7 Window and door frames. . . . . . . . . . . . . . . . . 304.13 5(&25' Official records. . . . . . . . . . . . . . . . . . . . . . . . . . 104.6 5(3$,5 Application of other codes . . . . . . . . . . . . . . . . . 102.3 Chimneys. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.11 Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110.1 Exterior surfaces . . . . . . . . . . . . . . . . . . . . . . . . 304.1 Intent . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.3 Maintenance . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.2 Signs, marquees and awnings. . . . . . . . . . . . . . 304.9 Stairs and porches. . . . . . . . . . . . . . . . . . . . . . 304.10 Weather tight . . . . . . . . . . . . . . . . . . . . . . . . . . 304.13 Workmanship. . . . . . . . . . . . . . . . . . . . . . . . . . . 102.5 5(32576 Test reports . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3.2 5(6,'(17,$/ Pest elimination . . . . . . . . . . . . . . . . . . . . . . . . . . 309 Residential heating . . . . . . . . . . . . . . . . . . . . . . 602.2 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 5(63216,%,/,7< Pest elimination . . . . . . . . . . . . . . . . . . . . . . . . . . 309 Fire safety . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 701.2 Garbage disposal. . . . . . . . . . . . . . . . . . . . . . . . 308.3 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.2 Mechanical and electrical . . . . . . . . . . . . . . . . . 601.2 Persons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.1 Placarding of structure. . . . . . . . . . . . . . . . . . . . 108.4 Plumbing facilities . . . . . . . . . . . . . . . . . . . . . . . 501.2 Rubbish storage. . . . . . . . . . . . . . . . . . . . . . . 308.2.1 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2, 301.1 5(92.(5(029( Demolition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 110 Existing remedies . . . . . . . . . . . . . . . . . . . . . . . 102.4 Removal of placard . . . . . . . . . . . . . . . . . . . . 108.4.1 Rubbish removal . . . . . . . . . . . . . . . . . . . . . . 308.2.1 5,*+72)(175< Duties and powers of code official. . . . . . . . . . . 104.3 Inspections. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 104.2 52'(176 Basement hatchways. . . . . . . . . . . . . . . . . . . .304.16 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Foundations . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.5 Guards for basement windows. . . . . . . . . . . . .304.17 Harborage . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.5 Insect and rodent control . . . . . . . . . . . . . . . . . .309.1 Pest elimination . . . . . . . . . . . . . . . . . . . . .302.5, 309 522) Exterior structure . . . . . . . . . . . . . . . . . . . . . . . .304.1 Roofs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.7 Storm drainage. . . . . . . . . . . . . . . . . . . . . . . . . . . 507 5220 Bedroom and living room. . . . . . . . . . . . . . . . . .404.4 Cooking facilities . . . . . . . . . . . . . . . . . . . . . . . .403.3 Direct access . . . . . . . . . . . . . . . . . . . . . . . . . . .503.2 Habitable . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .402.1 Heating facilities. . . . . . . . . . . . . . . . . . . . . . . . . . 602 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 Minimum ceiling heights. . . . . . . . . . . . . . . . . . .404.3 Minimum width. . . . . . . . . . . . . . . . . . . . . . . . . .404.2 Overcrowding. . . . . . . . . . . . . . . . . . . . . . . . . . .404.5 Prohibited use . . . . . . . . . . . . . . . . . . . . . . . . 404.4.4 Temperature. . . . . . . . . . . . . . . . . . . . . . . . . . . .602.5 Toilet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503 Ventilation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403 5220,1*+286(66HH'250,725< 58%%,6+ Accumulation . . . . . . . . . . . . . . . . . . . . . . . . . . .308.1 Definition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Disposal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .308.2 Garbage facilities . . . . . . . . . . . . . . . . . . . . . . 308.3.1 Rubbish storage. . . . . . . . . . . . . . . . . . . . . . . 308.2.1 6 6$)(7<6$)( Fire safety requirements . . . . . . . 701, 702, 703, 704 Safety controls . . . . . . . . . . . . . . . . . . . . . . . . . .603.4 6$1,7$5< Cleanliness. . . . . . . . . . . . . . . . . . . . . . . 304.1, 305.1 Disposal of garbage. . . . . . . . . . . . . . . . . . . . . .308.3 Disposal of rubbish. . . . . . . . . . . . . . . . . . . . . . .308.2 Exterior property areas. . . . . . . . . . . . . . . . . . . .302.1 Exterior structure . . . . . . . . . . . . . . . . . . . . . . . .304.1 Food preparation . . . . . . . . . . . . . . . . . . . . . . . .404.7 Furnished by occupant. . . . . . . . . . . . . . . . . . . .302.1 Grease interceptors . . . . . . . . . . . . . . . . . . . . . .506.3 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Plumbing fixtures . . . . . . . . . . . . . . . . . . . . . . . .504.1 Required plumbing facilities. . . . . . . . . . . . . . . . . 502 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .101.2 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 6&5((16 Insect screens . . . . . . . . . . . . . . . . . . . . . . . . .304.14 6(&85,7< Basement hatchways . . . . . . . . . . . . . . . . . . 304.18.3 Building . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .304.18 Doors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.18.1 Vacant structures and land. . . . . . . . . . . . . . . . .301.3 Windows. . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.18.2 6(/)&/26,1*6&5((1'2256 Insect screens . . . . . . . . . . . . . . . . . . . . . . . . .304.14 6(3$5$7,21 Fire-resistance ratings . . . . . . . . . . . . . . . . . . . . . 703 Privacy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .404.1 Separation of units . . . . . . . . . . . . . . . . . . . . . . .404.1 6(59,&( Electrical. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .604.2 Method . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .107.3 Notices and orders . . . . . . . . . . . . . . . . . 107.1, 108.3 Service on occupant. . . . . . . . . . . . . . . . . . . . . .108.3 6(:(5 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .506.1 Maintenance. . . . . . . . . . . . . . . . . . . . . . . . . . . .506.2 6+2:(5 Bathtub or shower . . . . . . . . . . . . . . . . . . . . . . .502.1 Rooming houses. . . . . . . . . . . . . . . . . . . . . . . . .502.2 Water-heating facilities . . . . . . . . . . . . . . . . . . . .505.4 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 6,*1 Fire door signs . . . . . . . . . . . . . . . . . . . . . . . . 703.4.1 Signs, marquees and awnings . . . . . . . . . . . . . .304.9 Unauthorized tampering . . . . . . . . . . . . . . . . . . .107.4 6,1*/()$0,/<':(//,1* Extermination . . . . . . . . . . . . . . . . . . . . . . . . . . . . 309 6,1. Kitchen sink . . . . . . . . . . . . . . . . . . . . . . . . . . . .502.1 Sewage system . . . . . . . . . . . . . . . . . . . . . . . . . . 506 Water supply. . . . . . . . . . . . . . . . . . . . . . . . . . . .505.3 6,=( Efficiency unit . . . . . . . . . . . . . . . . . . . . . . . . . . .404.6 Habitable room, light. . . . . . . . . . . . . . . . . . . . . . . 402 Habitable room, ventilation. . . . . . . . . . . . . . . . . . 403 Room area . . . . . . . . . . . . . . . . . . . . . . . . . . . 404.4.1 602.($/$506 Group R-1. . . . . . . . . . . . . . . . . . . . . . . . . . .704.6.1.1 Groups R-2, R-3, R-4 and I-1 . . . . . . . . . . . .704.6.1.2 Installation near bathrooms . . . . . . . . . . . . .704.6.1.4 Installation near cooking appliances. . . . . . .704.6.1.3 Interconnection . . . . . . . . . . . . . . . . . . . . . . . 704.6.2 Power source . . . . . . . . . . . . . . . . . . . . . . . . . 704.6.3 Testing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .704.7 Where required. . . . . . . . . . . . . . . . . . . . . . . . 704.6.1 63$&( General, light. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 General, ventilation. . . . . . . . . . . . . . . . . . . . . . . . 403 Occupancy limitations. . . . . . . . . . . . . . . . . . . . . . 404 Privacy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 404.1 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 401.1 67$&. Smoke. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.11 67$,56 Common halls and stairways, light . . . . . . . . . . 402.2 Exit facilities . . . . . . . . . . . . . . . . . . . . . . . . . . . 305.4 Exterior property areas . . . . . . . . . . . . . . . . . . . 302.3 Handrails. . . . . . . . . . . . . . . . . . . . . . . . 304.12, 305.5 Lighting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 605.3 Stairs and porches . . . . . . . . . . . . . . . . . . . . . 304.10 67$1'$5' Referenced . . . . . . . . . . . . . . . . . . . . . . . . . . . . 102.7 6723:25.25'(5 Authority . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112.1 Emergencies. . . . . . . . . . . . . . . . . . . . . . . . . . . 112.3 Failure to comply. . . . . . . . . . . . . . . . . . . . . . . . 112.4 Issuance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 112.2 6725$*( Food preparation. . . . . . . . . . . . . . . . . . . . . . . . 404.7 Garbage storage facilities. . . . . . . . . . . . . . . . . 308.3 Rubbish storage facilities . . . . . . . . . . . . . . . . 308.2.1 Sanitation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 308.1 6758&785( Accessory structures. . . . . . . . . . . . . . . . . . . . . 302.7 Closing of vacant structures . . . . . . . . . . . . . . . 108.2 Definition. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 Emergency measures. . . . . . . . . . . . . . . . . . . . . . 109 General, condemnation. . . . . . . . . . . . . . . . . . . . . 110 General, exterior. . . . . . . . . . . . . . . . . . . . . . . . 304.1 General, interior structure. . . . . . . . . . . . . . . . . 305.1 Placarding of structure . . . . . . . . . . . . . . . . . . . 108.4 Scope . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301.1 Structural members. . . . . . . . . . . . . . . . . 304.4, 305.2 Vacant structures and land. . . . . . . . . . . . . . . . 301.3 6833/< Combustion air . . . . . . . . . . . . . . . . . . . . . . . . . 603.5 Public water system . . . . . . . . . . . . . . . . . . . . . 505.1 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 Water supply. . . . . . . . . . . . . . . . . . . . . . . . . . . 505.3 Water system . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 685)$&( Exterior surfaces. . . . . . . . . . . . . . . . . . . 304.2, 304.6 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . 305.3 6:,00,1* Enclosure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 303.2 Safety covers . . . . . . . . . . . . . . . . . . . . . . . . . . 303.2 Swimming pools . . . . . . . . . . . . . . . . . . . . . . . . 303.1 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( 7 7(03(5$785( Nonresidential structures. . . . . . . . . . . . . . . . . . 602.4 Residential buildings . . . . . . . . . . . . . . . . . . . . . 602.2 Water-heating facilities . . . . . . . . . . . . . . . . . . . 505.4 7(1$17 Scope. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 101.2 7(677(67,1* Agency. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3.1 Methods. . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3.1 Reports . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3.2 Required . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 105.3 72;,& Process ventilation. . . . . . . . . . . . . . . . . . . . . . . 403.4 75$6+ Rubbish and garbage . . . . . . . . . . . . . . . . . . . . . 308 8 812%6758&7(' Access to public way . . . . . . . . . . . . . . . . . . . . . 702.1 General, egress . . . . . . . . . . . . . . . . . . . . . . . . . 702.1 816$)(6758&785(6$1'(48,30(17 Abatement methods. . . . . . . . . . . . . . . . . . . . . . 108.6 Dangerous structure or premises . . . . . . . . . 108.1.5 Equipment . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1.2 Existing remedies . . . . . . . . . . . . . . . . . . . . . . . 102.4 General, condemnation . . . . . . . . . . . . . . . . 108, 110 General, demolition . . . . . . . . . . . . . . . . . . . . . . . 110 Notices and orders. . . . . . . . . . . . . . . . . . . 107, 108.3 Record . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.7 Structures . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.1.1 86( Application of other codes . . . . . . . . . . . . . . . . . 102.3 General, demolition . . . . . . . . . . . . . . . . . . . . . . . 110 87,/,7,(6 Authority to disconnect . . . . . . . . . . . . . . . . . 108.2.1 9 9$&$17 Abatement methods. . . . . . . . . . . . . . . . . . . . . . 108.6 Authority to disconnect service utilities . . . . . 108.2.1 Closing of vacant structures . . . . . . . . . . . . . . . 108.2 Emergency measure . . . . . . . . . . . . . . . . . . . . . . 109 Method of service . . . . . . . . . . . . . . . . . 107.3, 108.3 Notice to owner or to person responsible. . . . . . . . . . . . . . . . . 107, 108.3 Placarding of structure. . . . . . . . . . . . . . . . . . . . 108.4 Record . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 108.7 Vacant structures and land . . . . . . . . . . . . . . . . 301.3 9$325 Exhaust vents . . . . . . . . . . . . . . . . . . . . . . . . . . 302.6 9(+,&/(6 Inoperative . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.8 Painting . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.8 9(17 Plumbing hazard . . . . . . . . . . . . . . . . . . . . . . . .504.3 Exhaust vents. . . . . . . . . . . . . . . . . . . . . . . . . . .302.6 Flue . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .603.2 9(17,/$7,21 Clothes dryer exhaust . . . . . . . . . . . . . . . . . . . .403.5 Combustion air. . . . . . . . . . . . . . . . . . . . . . . . . .603.5 Definition . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 202 General, ventilation . . . . . . . . . . . . . . . . . . . . . . . 403 Habitable rooms. . . . . . . . . . . . . . . . . . . . . . . . .403.1 Process ventilation. . . . . . . . . . . . . . . . . . . . . . .403.4 Recirculation . . . . . . . . . . . . . . . . . . . . . 403.2, 403.4 Toilet rooms . . . . . . . . . . . . . . . . . . . . . . . . . . . .403.2 9(50,1 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Insect and rodent control . . . . . . . . . . . . . .302.5, 309 9(57,&$/6+$)76 Required enclosure . . . . . . . . . . . . . . . . . . . . . .703.7 9,2/$7,21 Condemnation . . . . . . . . . . . . . . . . . . . . . . . . . . . 108 Enforcement. . . . . . . . . . . . . . . . . . . . . . . . . . . .106.2 General . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 106 Notice. . . . . . . . . . . . . . . . . . . . . . . . . . . . .107, 108.3 Separate offenses . . . . . . . . . . . . . . . . . . . . . . .106.4 Placarding of structure. . . . . . . . . . . . . . . . . . . .108.4 Prosecution . . . . . . . . . . . . . . . . . . . . . . . . . . . .106.3 Strict liability offense . . . . . . . . . . . . . . . . .106.3, 202 Transfer of ownership . . . . . . . . . . . . . . . . . . . .107.6 : :$/. Sidewalks. . . . . . . . . . . . . . . . . . . . . . . . . . . . . .302.3 :$// Accessory structures . . . . . . . . . . . . . . . . . . . . .302.7 Exterior surfaces . . . . . . . . . . . . . . . . . . 304.2, 304.6 Exterior walls . . . . . . . . . . . . . . . . . . . . . . . . . . .304.6 Foundation walls . . . . . . . . . . . . . . . . . . . . . . . .304.5 General, fire-resistance rating . . . . . . . . . . . . . .703.1 Interior surfaces . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Outlets required . . . . . . . . . . . . . . . . . . . . . . . . .605.2 Temperature measurement . . . . . . . . . . . . . . . .602.5 :$67( Disposal of garbage. . . . . . . . . . . . . . . . . . . . . .308.3 Disposal of rubbish. . . . . . . . . . . . . . . . . . . . . . .308.2 Garbage storage facilities . . . . . . . . . . . . . . . 308.3.1 :$7(5 Basement hatchways. . . . . . . . . . . . . . . . . . . .304.16 Connections. . . . . . . . . . . . . . . . . . . . . . . . . . . .506.1 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,1'(; ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Contamination . . . . . . . . . . . . . . . . . . . . . . . . . .505.2 General, sewage . . . . . . . . . . . . . . . . . . . . . . . . . 506 General, storm drainage. . . . . . . . . . . . . . . . . . . . 507 General, water system . . . . . . . . . . . . . . . . . . . . . 505 Heating . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .505.4 Hotels . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .502.3 Kitchen sink . . . . . . . . . . . . . . . . . . . . . . . . . . . .502.1 Nonpotable water reuse . . . . . . . . . . . .505.5, 505.5.1 Required facilities . . . . . . . . . . . . . . . . . . . . . . . . . 502 Rooming houses. . . . . . . . . . . . . . . . . . . . . . . . .502.2 Supply. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .505.3 System . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 505 Toilet rooms . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 503 Water-heating facilities . . . . . . . . . . . . . . . . . . . .505.4 :($7+(5&/,0$7( Heating facilities . . . . . . . . . . . . . . . . . . . . . . . . . . 602 :(('6 Noxious weeds . . . . . . . . . . . . . . . . . . . . . . . . . .302.4 :,'7+ Minimum room width . . . . . . . . . . . . . . . . . . . . .404.2 :,1'2: Emergency escape. . . . . . . . . . . . . . . . . . . . . . .702.4 Glazing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 304.13.1 Guards for basement windows. . . . . . . . . . . . .304.17 Habitable rooms . . . . . . . . . . . . . . . . . . . . . . . . .402.1 Insect screens . . . . . . . . . . . . . . . . . . . . . . . . .304.14 Interior surface . . . . . . . . . . . . . . . . . . . . . . . . . .305.3 Light . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 402 Openable windows . . . . . . . . . . . . . . . . . . . . 304.13.2 Toilet rooms . . . . . . . . . . . . . . . . . . . . . . . . . . . .403.2 Ventilation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 403 Weather tight . . . . . . . . . . . . . . . . . . . . . . . . . .304.13 Window and door frames . . . . . . . . . . . . . . . . .304.13 :25.0$16+,3 General. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .102.5 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ,17(51$7,21$/3523(57<0$,17(1$1&(&2'( Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 People Helping People Build a Safer World® * Some restrictions apply. Speak with an ICC Member Services Representative for details. 16-12897 BENEFITS THAT WORK FOR YOU No matter where you are in your building career, put the benefits of ICC Membership to work for you! Membership in ICC connects you to exclusive I-Codes resources, continuing education opportunities and Members-Only benefits that include: · Free code opinions from I-Codes experts · Free I-Code book(s) or download to new Members* · Discounts on I-Code resources, training and certification renewal · Posting resumes and job search openings through the ICC Career Center · Mentoring programs and valuable networking opportunities at ICC events · Free benefits — Corporate and Governmental Members: Your staff can receive free ICC benefits too* · Savings of up to 25% on code books and training materials and more Put the benefits of ICC Membership to work for you and your career. Visit www.iccsafe.org/mem3 to join now or to renew your Membership. Or call 1-888-ICC-SAFE (422-7233), ext. 33804 to learn more today! Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 ICC Plan Review Services… For the most detailed and precise Plan Reviews in the industry Ever wonder why code officials, architects and other building professionals value and accept ICC plan reviews? • Experience – Our I-Code experts have expertise in ALL the International Codes® (I-Codes®) • Detailed Report – identifies code deficiencies found • Complimentary re-review of reissued plans* Plus, ICC Plan Review Services has over 200 years of combined experience with applications of the codes, 6 registered design professionals on staff and 120 International Code Council Certifications, so you can be assured that ICC will deliver the most detailed and precise plan reviews in the industry. *Applies to “Complete Plan Review Services”. Contact ICC Plan Review staff for details. To get your plan review started now or to learn about disciplines reviewed, plan review options and more, visit www.iccsafe.org/plr4 or call 888-422-7233, x5577. 17-14096 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 People Helping People Build a Safer World® 17-14099 Looking for the missing piece? Solve the puzzle and advance your career with ICC University ICC University has been built from the ground up with you in mind. Take advantage of tools to help you better track and manage your career growth and professional development, including automatic CEU tracking and simplified search options to find code training. Plan for your future and manage your professional development from one, easy-to-use location. ICC University provides you with: • Simplified access to over 300 training options • Automatic CEU tracking to keep you on track for recertification • Robust curriculums that identify supporting courses, publications and exam study materials to assist you in preparing for certification exams and achieving your next professional milestone • The ability to purchase all courses, related publications and exam preparation materials – as well as register for certification exams – from a single screen • And more! www.iccsafe.org/ExploreICCU kk al ng anddg Plan for your Plan our ment from one,fme e,one Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 Valuable Guides to Changes in the 2018 I-Codes® SIGNIFICANT CHANGES TO THE 2018 INTERNATIONAL CODES® Practical resources that offer a comprehensive analysis of the critical changes made between the 2015 and 2018 editions of the codes. Authored by ICC code experts, these useful tools are “must-have” guides to the many important changes in the 2018 International Codes. Key changes are identified then followed by in-depth, expert discussion of how the change affects real world application. A full-color photo, table or illustration is included for each change to further clarify application. ORDER YOUR HELPFUL GUIDES TODAY! 1-800-786-4452 | www.iccsafe.org/books NEW! FULL COLOR! HUNDREDS OF PHOTOS AND ILLUSTRATIONS! HIRE ICC TO TEACH Want your group to learn the Significant Changes to the I-Codes from an ICC expert instructor? Schedule a seminar today! email: ICCTraining@iccsafe.org | phone: 1-888-422-7233 ext. 33818 SIGNIFICANT CHANGES TO THE IBC, 2018 EDITION #7024S18 SIGNIFICANT CHANGES TO THE IRC, 2018 EDITION #7101S18 SIGNIFICANT CHANGES TO THE IFC, 2018 EDITION #7404S18 SIGNIFICANT CHANGES TO THE IPC/IMC/IFGC, 2018 EDITION #7202S18 People Helping People Build a Safer World® 17-14098 Copyright © 2017 ICC. ALL RIGHTS RESERVED. Accessed by Melissa Poehlman (mpoehlman@richfieldmn.gov), (-) Order Number #100727338 on Jul 09, 2019 09:02 AM (PDT) pursuant to License Agreement with ICC. No further reproduction or distribution authorized. Single user only, copying and networking prohibited. ANY UNAUTHORIZED REPRODUCTION OR DISTRIBUTION IS A VIOLATION OF THE FEDERAL COPYRIGHT ACT AND THE LICENSE AGREEMENT, AND SUBJECT TO CIVIL AND CRIMINAL PENALTIES THEREUNDER. 100727338 AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.E. STAFF RE P ORT NO. 19 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Joe P owers, A ssistant C ity E ngineer D E PA RTME NT D IRE C TO R RE V IE W: K ristin A sher, P ublic Works D irector 1/21/2020 O THE R D E PA RTM E NT RE V IE W: N/A C ITY MA NA G E R RE V IE W: K atie Rodriguez, C ity Manager 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the approval of a Construction and Maintenance Agreement with Morrie's Richfield JR L R E, LL C (Morrie's Jaguar Land Rover) that defines ownership and maintenance responsibilities for certain features constructed at 1525 East 77th Street. E X E C UT IV E S UM M ARY: The properties at 1525 East 77th Street were redeveloped to construct a new auto dealership. The construction included site improvements on both public and private property. T he City has worked with the Developer to draft a Construction and Maintenance Agreement that defines ownership and maintenance responsibilities for the site and boulevard improvements constructed during the redevelopment project. T hese improvements and responsibilities include: Sidewalk and Sidewalk Snow Removal Landscaping and I rrigation Boulevard Trees Street and Sidewalk Lighting Stormwater Control Devices RE C O M M E ND E D AC T I O N: By Motion: Approve the Construction and Maintenance Agreement with Morries Richfield J R L R E, LL C (Morries Jaguar Land Rover) for the site at 1525 East 77th Street. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T T he City required the redevelopment to provide stormwater quality treatment before stormwater enters the City system. T he onsite treatment structures will help remove pollutants and particles before the water enters the public system. In order for the treatment structure to function as designed, it must be inspected and cleaned regularly. Drainage improvements were also constructed on the site and include an underground stormwater detention system and outlet control structures which temporarily store stormwater on the property before delivering it to the public system. In order for the detention system to function as designed, it must be inspected and maintained regularly. The Agreement provides direction on inspection, repair, replacement, and maintenance of the treatment structure, detention system, and the public improvements, in addition to the remedies for the failure to comply with the provisions of this agreement. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): The City requires a Construction and Maintenance Agreement for redevelopment projects containing boulevard improvements and/or stormwater treatment structures. C.C R IT IC AL T IMIN G IS S U E S: No critical timing issues are identified. D.F IN AN C IAL IMPAC T: The Agreement requires the property owner to cover all costs related to inspection and maintenance of the stormwater system. The Agreement requires the property owner to reimburse the City for any costs incurred in performing activities identified as the responsibility of the property owner. Financial responsibilities of other items varies per the agreement. E.L E GAL C ON S ID E R AT ION: The City Attorney was consulted during the negotiations of terms and has reviewed the agreement. ALTE R N AT IV E R E C O MME N D ATIO N(S): None P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None AT TAC H ME N T S: D escription Type Morrie's C onstruction and Maintenance A greement C ontract/A greement E xhibit A - Morrie's C onstruction and Maintenance A greement E xhibit E xhibit D - Morrie's C onstruction and Maintenance A greement E xhibit CONSTRUCTION AND MAINTENANCE AGREEMENT This construction and maintenance agreement ("Agreement"), made and entered into as of the + � day of ti Wd , 20'Zby and between Morries Richfield JLR RE, LLC a Minnesota Limited Liability comps y ("Developer") and the City of Richfield, Minnesota, a Minnesota municipal corporation ("City") RECITALS A. Developer owns certain real property located in the City of Richfield, legally described in the attached Exhibit A ("Property"). B. Developer has begun construction of buildings and related site improvements ("Site Improvements") on the Property and intends to construct a parking lot on the Property. C. The City requires that certain stor7nwater improvements, described in attached Exhibit B ("Stormwater Improvements"), be constructed and maintained to ensure proper discharge of storm water into the City's storm sewer system ("City System"), D. The City requires the construction of certain improvements and betterments ("Public Area Improvements" — Described in attached Exhibit C) on portions of the City right. of- way and public easements abutting the Property (collectively, the "Public Areas"). • E. For the purpose of providing the basis for design, construction, repair, replacement, and maintenance of the Stormwater Improvements and Public Area improvements, the parties wish to enter into this Agreement, including setting forth the remedies for failure to comply with this Agreement. AGREEMENT For good and valuable consideration, the receipt and sufficiency of which the parties acknowledge, the parties agree as follows: Stormwater Ym rovements 1. Desi�t�. The City has reviewed and approved plans and specifications for the Stormwater Improvements; such review and approval occurred prior to commencement of construction. The City may reject the final construction if it does not meet the City standards or comply with the approved plans. The Developer is responsible for any costs to bring the construction into compliance with City standards or the approved plans. 2. Construction. The Developer shall construct and pay for the cost of construction of the Stormwater Improvements. 3. inspection and Cleaning. 1 2 a.Frequency.The Developer shall be responsible for inspecting and cleaning the Stormwater Improvements, including the storm sewer, storm sewer structures, stormwater treatment systems, and draintile,at least annually, unless a more frequent inspection or cleaning is requested by the City.The Contech Jellyfish Filter Vault and the Contech CMP Detention System shall be inspected and maintained by the Developer per manufacturer recommendations, as included in the attached Exhibit B. b.Costs.The Developer shall cover the cost of all such inspections and cleanings. c.Annual Report.The Developer shall provide the City with an annual report documenting the inspection and maintenance of the Stormwater Improvements on or before December 31 of each year. 4.Right of Access and City Maintenance Rights. The Developer grants to the City, its agents and employees, the right to enter the Property to conduct periodic inspections.If the Developer fails to adhere to Section 3, the City has the right to clean, repair, and replace all or portions of the Stormwater Improvements and assess costs to the Developer. PUBLIC AREA IMPROVEMENTS 5.Construction, Installation, Maintenance, Repair, and Replacement. The parties agree to undertake the responsibilities for the construction, installation, maintenance, repair, and replacement of Public Area Improvements as described in the attached Exhibit D. 6.City Review of Work. The City has reviewed and approved the plans and specifications for all work done within the Public Areas by Developer. 7.Additional Snow Removal.The City will provide basic snow removal on the public sidewalks along 77th Street and Bloomington Avenue.Developer shall be responsible for providing,and paying expenses for,any additional snow removal or treatment it desires beyond the City’s obligation in Exhibit D.Sidewalk damage, or damage to adjacent areas, due to the use of heavy equipment, excessive salt or other chemical disbursement, or any other damage caused by Developer will be repaired by Developer at the Developer’s expense.Work performed under this paragraph is subject to Right of Access,Insurance,and Indemnity provisions. 8.Right of Access. a.Subject to compliance with any preconditions contained in the City Code, the City grants to the Developer, its agents and employees the right to enter onto the Public Areas to perform the work required to be performed by the Developer pursuant to paragraphs 5 and 6. b.The Developer agrees that it will not interfere with the public use of the Public Areas. c. The Developer will notify the City and any other agency having jurisdiction over, or an interest in, the Public Areas or abutting streets and highways at least 48 hours in advance of any scheduled work. Developer will comply with any requirements of the City or such other agency governing signage and other regulations governing work in the Public Areas including, without limitation, obtaining any additional permits, licenses, or approvals needed for the doing of such work. d. Developer grants to the City, its agents and employees, the right to enter onto the Property to maintain items as identified in Exhibit D. 9. Ownership. a. Exhibit C designates Public Area Improvements which are to be constructed by Developer and conveyed to the City following the City inspection of the work and notification to the Developer that it will accept conveyance. b. Developer warrants that such conveyance is free and clear of any mechanic's liens or encumbrances other than Developer's first priority mortgage in favor of its lender. c. Any warranties available as a result of construction of such Public Area Improvements will be assigned to the City, and, to the extent available, will be utilized to offset Developer's maintenance obligations hereunder. 10. Maintenance, Repair and Replacement Obligation. The party having the maintenance, repair, or replacement obligation, as outlined in this Agreement and the attached exhibits, shall have the affirmative obligation of assuring the item to which the obligation attaches is always kept in good, safe, operable and presentable condition. If the City becomes aware of a condition relating to an item for which the Developer is obligated, it shall notify the Developer in writing whereupon the Developer shall promptly inspect, and as needed, maintain, repair, or replace the item within 30 days of the date of such notification by the City. 11. No Salt Storage. Developer shall not store, on or within the Stormwater Improvements or the Public Areas, salt or other similar chemicals used to treat snow and ice. 12. Default. If either party defaults in any of its obligations hereunder, after notice of such default and failure to cure within 30 days following such notification, unless extended upon mutual agreement of the parties, the non-defaulting party may pursue whatever remedies are available to it at law or in equity. The non-defaulting party may also terminate this Agreement following such notice and the failure to cure, except that the Developer's obligation to construct, repair, maintain and reconstruct the Stormwater Improvements shall survive such termination. In addition to such remedies, if the Developer is the defaulting party, and the default relates to activities within the Public Areas, the City may, after such notice and cure period, perform the work and recover the entire cost of such work against the Developer through 3 a lien against the Property to be collected as a special assessment. The Developer agrees and stipulates that any such work will be for the betterment of the Property, and that the value of the Property will be increased by at least the cost to the work. The Developer for itself, its successors and assigns, waives any challenge to the amount of the assessment for such work, and waives its right to a hearing on the assessment or to challenge the assessment following its being levied. In addition to placing an assessment lien against the Property, the City may also seek to impose and collect a lien pursuant to Minnesota Statutes, Section 514.67. 13. Miscellaneous Provisions. a. Insurance. The Developer will, during the term of this Agreement, maintain coverages from insurance companies acceptable to the City, at levels acceptable to the City insuring against claims for injury, death or property damage or death caused by any activities conducted by Developer, its officers, agents or employees within the Public Areas and the failure of Developer, as obligated hereunder, to properly maintain, repair, or replace Public Area Improvements. b. Indemnity. The Developer also hereby indemnifies, holds harmless and agrees to defend the City, its officers, agents and employees from any claims or causes of action occasioned by or arising out of the Developer's activities or failure to perform activities under this Agreement. The Developer's undertaking in the last sentence shall not extend to claims which are the result of the negligence or the willful misconduct of the City, its officers, agents or employees. c. Term. Unless earlier terminated as provided in Paragraph 11, this Agreement shall remain in full force and effect until terminated by the mutual written agreement of the parties. d. Binding Effect. All duties and obligations of the Developer under this Agreement shall also be duties and obligations of the Developer's successors and assigns. The terms and conditions of this Agreement shall run with the land and shall be recorded with the property records of Hennepin County, Minnesota. e. Recording. The City shall record this Agreement among the land records, within 60 days of the date hereof, and shall pay for the cost of such recording. f. Other Approvals. This Agreement shall not relieve Developer from the need to obtain all licenses, permits and approvals which are required by the City and other permitting and licensing authorities to allow for the development of the Property. Nor shall this Agreement be deemed a waiver of the City's legislative judgment in considering the granting of any such licenses, permits or approvals. Additionally, no structure or improvement which is the subject of this Agreement may be constructed until any necessary land use approvals and/or variances have first been obtained. g. No Interest i11 Land. This Agreement does not create any property or ownership interest of the Developer in the Public Areas. This Agreement only gives 4 Developer the permission to occupy and utilize the Public Areas consistent with provisions and limitations of this Agreement. h. Notices. City: City of Richfield 6700 Portland A venue S. Richfield, MN 55423 Attn: City Engineer Developer: Morries Richfield JLR RE, LLC 12520 Wayzata Blvd Minnetonka, MN 55305 Attn: Phillip Branson i. Severability. If any provision of this Agreement is invalid or unenforceable, such provision, if feasible, shall be deemed to be modified to be within the limits of enforceability or validity; if, however, the offending provision cannot be so modified, it shall be stricken and all other provisions of this Agreement in all other respects shall remain valid and enforceable. j. Entire Agreement. This Agreement, including the exhibits, contains the entire agreement between the parties pertaining to the subject matter hereof and fully supersedes all prior written or oral agreements and understandings between the parties pertaining to such subject matter. k. Amendment. This Agreement shall not be modified, amended, supplemented or revised, except by a written document signed by the parties. 1. Exhibits. All exhibits referred to in and attached to this Agreement are incorporated and made a part of this Agreement. m. Counterpart SignatUl'es. This Agreement may be executed simultaneously in two or more counterparts, each of which shall be deemed original, and all of which shall constitute one and the same instrument. [Signatures on Following Page] 5 IN WITNESS WHEREOF, the parties hereto have executed, or caused to be executed by their duly authorized officials, this Agreement as of the date first written above. CITY OF RICHFIELD Its Mayor Its City Manager The foregoing instrument was acknowledged before me this _ day of , 20 by and , the Mayor and City Manager respectively, of the City of Richfield, a Minnesota municipal corporation, on behalf of the municipal corporation. Notary Public OWNER :�� The foregoing instrument was acknowledged before me this 17th day of January, 2020, by Phillip A. Branson, the Director of Real Estate, on behalf of Owner. JACKLYN S PLATT NOTARY PUBLIC - MINNESOTA MY COMMISSION EXPIRES 01/31/23 6 EXHIBIT A LEGAL DESCRIPTION The North 180.26 feet of the West 490 feet of the South 1/2 of the Southeast Quarter of the Southeast Quarter; That Part of the West 330 feet of the South 1/2 of the Southeast Quarter of the Southeast Quarter lying South of the North 180.26 feet thereof; All in Section 35, Township 28, Range 24, Hennepin County, Minnesota. Torrens Property - Certificate of Title No. 1311180 7 Exhibit D 1525 East 77th Street, Richfield, MN 55423 –Morrie’s Jaguar Land Rover Public Area Improvements Public Area Feature Ownership Construction and Installation Responsibility Maintenance, Repair, Replacement Responsibility Responsible for the Cost of Operation & Maintenance Inspection & Maintenance Cycle Sidewalk City Developer City City Annually Sidewalk Snow Removal City N/A See Paragraph 7 See Paragraph 7 As needed Landscaping Developer Developer Developer Developer As needed Private Irrigation Developer Developer Developer Developer As needed Public Utilities (Storm, Sewer, Water) City Developer City City As needed Stormwater Improvements (Underground Retention System and Cartridge Filter System) Developer Developer Developer Developer Annually, or per manufacturer recommendations Pedestrian Sidewalk Lighting on 77th Street and Bloomington Avenue Developer Developer Developer Developer As needed Street Lighting City Developer City City As needed Boulevard Trees City Developer City City As needed AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.F. STAFF RE P ORT NO. 20 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Joe P owers, A ssistant C ity E ngineer D E PA RTME NT D IRE C TO R RE V IE W: K ristin A sher, P ublic Works D irector 1/21/2020 O THE R D E PA RTM E NT RE V IE W: N/A C ITY MA NA G E R RE V IE W: K atie Rodriguez, C ity Manager 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the approval of a Construction and Maintenance Agreement with N O V O, LL C that defines ownership and maintenance responsibilities for certain features constructed at 2400 West 66th Street. E X E C UT IV E S UM M ARY: The properties at 2400 West 66th Street are being redeveloped to construct a single multi-unit apartment building. The construction includes site improvements on both public and private property. T he City has worked with the Developer to draft a Construction and Maintenance Agreement that defines ownership and maintenance responsibilities for the site and boulevard improvements constructed during the redevelopment project. T hese improvements and responsibilities include: Sidewalk and Sidewalk Snow Removal Landscaping and I rrigation Boulevard Trees Street and Sidewalk Lighting Storm water Control Devices RE C O M M E ND E D AC T I O N: By Motion: Approve the Construction and Maintenance Agreement with N O V O, L LC for the site at 2400 W est 66th Street. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T T he City is requiring the redevelopment to provide storm water quality treatment before storm water enters the City system. T he onsite treatment structure will help remove pollutants and particles before the water enters the public system. In order for the treatment structure to function as designed, it must be inspected and cleaned regularly. Drainage improvements are also being constructed on the site and include two underground storm water detention systems and outlet control structures which temporarily store storm water on the property before delivering it to the public system. In order for the detention systems to function as designed, they must be inspected and maintained regularly. T he redevelopment will construct a new public sidewalk along the west side of the redevelopment property. T he developer is granting a Sidewalk Easement to the City over the public sidewalk. The Agreement provides direction on inspection, repair, replacement, and maintenance of the treatment structure, detention systems, and the public improvements, in addition to the remedies for the failure to comply with the provisions of this agreement. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): The City requires a Construction and Maintenance Agreement for redevelopment projects containing boulevard improvements and/or storm water treatment structures. C.C R IT IC AL T IMIN G IS S U E S: No critical timing issues are identified. D.F IN AN C IAL IMPAC T: The City is taking ownership of the storm water detention system that is needed for the new Russel Ave. The Agreement requires the property owner to cover all costs related to inspection and maintenance of one of the storm water detention systems and the storm water treatment structure and a portion of costs relating to the second storm water detention system. The Agreement requires the property owner to reimburse the City for any costs incurred in performing activities identified as the responsibility of the property owner. Financial responsibilities of other items varies per the agreement. E.L E GAL C ON S ID E R AT ION: The City Attorney was consulted during the negotiations of terms and has reviewed the agreement. ALTE R N AT IV E R E C O MME N D ATIO N(S): None P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None AT TAC H ME N T S: D escription Type C onstruction, Maintenance and S idewalk E asement A greement C ontract/A greement CONSTRUCTION, MAINTENANCE AND SIDEWALK EASEMENT AGREEMENT This Construction, Maintenance and Sidewalk Easement Agreement (the "Agreement"), made and entered into as of the l � day ofD2(LW- 20i by and between NOVO, LLC, a Minnesota limited liability company ("Developer") and the City of Richfield, Minnesota, a Minnesota municipal corporation ("City") Recitals, 1. Developer is the owner of a certain tract and parcel of land lying within the City on land legally described in the attached Exhibit A ("Property"). 2. The Developer has undertaken the construction of buildings and related site improvements ("Site Improvements") on the Property. 2. The City has granted approval to Developer to construct a parking lot and related storm drainage improvements on the Property, which drainage improvements drain into the City's storm sewer system ("City System"). 3. The storm drainage improvements include an Underground Stormwater System 1.0, an Underground Stormwater System 2.0, and a Hydro International Treatment Structure ("Stormwater Improvements") all to be constructed by Developer that will provide rate control and treat storm water before it enters the City System. The Stormwater Improvements are designed to provide rate control, remove sand, gravel and other particles from the storm water passing through the Property prior to entry into the City System. The plans and specifications for the Stormwater Improvements, and a site plan showing its location on the Property are contained in the attached Exhibit B ("Civil Plans"). 4. In order for the Stormwater Improvements to function as designed, it must be inspected and maintained routinely. 5. In conjunction with the construction of the Site Improvements, certain improvements and betterments ("Public Area Improvements") are to be constructed on portions of the City right-of- way and public easements abutting the Property (collectively, the "Public Areas"). The Public Area Improvements are described and located on the site plan attached as Exhibit C ("Civil Plans"). 6. Also, and in conjunction with the construction of the Site Improvements, certain improvements, including a sidewalk are to be constructed on the Property by the Developer, along with the other Site Improvements; and pursuant to the terms of this Agreement, Developer has agreed to grant to the City a sidewalk easement over said sidewalk. 7. The parties are desirous of entering into this Agreement for the purpose of providing the basis for the design, construction, repair, replacement and maintenance of the Stormwater Improvements and the Public Area Improvements and setting forth the remedies for failure to comply with the provisions of this Agreement. Agreement For good and valuable consideration, the receipt and sufficiency of which the parties acknowledge, the parties agree as follows: 1. Stormwater Improvements. Design and Construction. The Developer shall construct and pay for the cost of construction of the Stormwater Improvements. Plans and Specifications for the Stormwater Improvements contained within the Developer's Civil Plans have been reviewed and hereby are approved by the City. The City may reject the plans, specifications or the final construction if they do not meet the City standards. The Developer is responsible for any costs to bring the plans or construction into compliance with City standards. 2. Stormwater Improvements; Inspection and Cleaning_ The Developer shall be responsible for inspecting and cleaning the Underground Stormwater System 1.0 and Hydro International Treatment Structure at intervals of once every 12 months, and more often as requested by the City. The Developer shall cover the cost of all such inspections and cleanings. The Developer shall provide the City with an annual report documenting the inspection and maintenance of the Underground Stormwater System 1.0 and Hydro International Treatment Structure on or before December 31 of each year. 3. Draiiia e hnpi-ovcments. Right of Access. The Developer -grants to the City, its agents and employees the right to enter onto the Property to conduct periodic inspections, and if the Developer defaults in their responsibilities, cleanings, repairs and replacements, following at least Thirty (30) days' notice to the Developer, the City may cure such default at the cost of the Developer, if the Developer fails to cure the default in the Thirty (30) day period. The City agrees that it will not unreasonably interfere with the Developer's use of the Property. At the request of the Developer, the area affected by this right of access shall be legally described and recorded as a supplemental agreement all at Developer's sole cost and expense. 4. Public Area improvements. Construction, Installation, Maintenance, Repair and Replacement. The parties agree to undertake the responsibilities for the construction, installation, maintenance, repair and replacement of Public Area Improvements, and the intervals for the doing of such work are all as described in Exhibit D. The City will have a reasonable time to review and approve, reject or require modifications to the plans and specifications for all work done within the Public Areas by Developer. In addition to the foregoing, the City will 2 provide basic snow removal on the public sidewalks along 661h Street and Russell Avenue. If the Developer desires additional removal or treatment, it may provide these services at its own expense. Any such additional removal is subject to the requirements of Paragraphs 5 and 7 b. Sidewalk damage, or damage to adjacent areas, due to the use of heavy equipment, excessive salt/chemical, and/or any other damage caused by the Developer will be repaired by Developer at the Developer's cost, and be such work is subject to the provisions of Paragraphs 5 and 7 b, and the cure provisions contained in Paragraph 7 c. The Developer will provide all snow removal on the public sidewalks along Russell Avenue; and the City will provide all snow removal on Russel Avenue 5. Public Area Improvements. Right of Access. Subject to compliance with any preconditions contained in the City Code, the City grants to the Developer, its agents and employees the right to enter onto the Public Areas to perform the work required to be performed by the Developer pursuant to Paragraph 4. The Developer agrees that it will not interfere with the public use of the Public Areas. The Developer will notify the City and any other agency having jurisdiction over, or an interest in, the Public Areas or abutting streets and highways at least 48 hours in advance of any scheduled work; and will comply with any requirements of the City or such other agency governing signage and other regulations governing work in the Public Areas including, without limitation obtaining any additional permits, licenses or approvals needed for the doing of such work. Developer grants to the City, its agents and employees, the right to enter onto the Property to maintain items as identified in Exhibit D. 6. Public Area Improvements. Ownership. Exhibit C designates the Boulevard Improvements which are to be constructed by Developer and conveyed to the City following the City inspection of the work and notification to the Developer that it will accept conveyance. Developer warrants that such conveyance is free and clear of any mechanic's liens or encumbrances other than Developer's first priority mortgage in favor of its lender. Any warranties available as a result of construction of such Public Area Improvements will be assigned to the City, and, to the extent available, will be utilized to offset Developer's maintenance obligations hereunder. 7. Sidewalk Easement. Developer, in consideration of the sum of One Dollar ($1.00) and other good and valuable consideration, the receipt of which is hereby acknowledged, does hereby grant and convey to the City, its successors and assigns, forever, a sidewalk easement over, under and across the portion of the Property described on Exhibit E, attached hereto and incorporated herein ("Sidewalk Easement"). The grant of the foregoing is a permanent easement for sidewalk purposes and includes the right of the City, its contractors, agents and servants, to construct, reconstruct, inspect, repair and maintain a sidewalk in conjunction with the public's use of said sidewalk within the Sidewalk Easement. Miscellaneous Provisions. a. Maintenance, repair and replacement obligation. The party having the maintenance, repair or replacement obligation shall have the affirmative obligation of assuring the item to which the obligation attaches is always kept in good, safe, operable and presentable condition. If the City becomes aware of a condition relating to an item for which the Developer 3 is obligated, it shall notify the Developer in writing whereupon the Developer shall promptly inspect, and as needed, maintain, repair or replace the item within 30 days of the date of such notification by the City; or such longer period if promptly take steps to ensure that the condition does not materially deteriorate and cure within Thirty (30) days is not feasible without incurring excess cost. b. Insurance,,Indemnity. The Developer will, during the term of this Agreement, maintain coverages from insurance companies acceptable to the City, at levels acceptable to the City insuring against claims for injury, death or property damage or death caused by any activities conducted by Developer, its officers agents or employees within the Public Areas; including, without limitation, the location of the Sign Structure within the Public Areas, and the failure of Developer, as obligated hereunder, to properly maintain, repair, or replace Public Area Improvements. The Developer also hereby indemnifies, holds harmless and agrees to defend the City, its officers, agents and employees from any claims or causes of action occasioned by or arising out of the Developer's activities or failure to perform activities under this Agreement. The Developer's undertaking in the last sentence shall not extend to claims which are the result of the negligence or the willful misconduct of the City, its officers, agents or employees. C. Default. If the either party defaults in any of its obligations hereunder, after notice of such default and failure to cure within 30 days following such notification, unless extended upon mutual agreement of the parties, the non defaulting party may pursue whatever remedies are available to in at law or in equity. In addition to such remedies, if the Developer is the defaulting party, and the default relates to activities within the Public Areas, the City may, after such notice and cure period perform the work and recover the entire cost of such work against the Developer through a lien against the Property to be collected as a special assessment. The Developer agrees and stipulates that any such work will be for the betterment of the Property, and that the value of the Property will be increased by at least the cost to the work. The Developer for itself, its successors and assigns waives any challenge to the amount of the assessment for such work, and waives its right to a hearing on the assessment of to challenge the assessment following its being levied. In addition to placing an assessment lien against the Property, the City may also seek to impose and collect a lien pursuant to Minnesota Statutes, Section 514.67. d. Term. This Agreement shall remain in full force and effect until terminated by the mutual written agreement of the parties. e. Successors and Assigns. This Agreement shall be binding on and inure to the benefit of the parties hereto and their respective successors and assigns. Developer will secure the joinder or consent of any holders of liens or encumbrances on the Property; and certifies and represents to the City that there are no liens or encumbrances affecting the Property for which consents or waivers have not been obtained. n f. Other Approvals. This Agreement shall not relieve Developer from the need to obtain all licenses, permits and approvals which are required by the City and other permitting and licensing authorities to allow for the development of the Property. Nor shall this Agreement be deemed a waiver of the City's legislative judgment in considering the granting of any such licenses, permits or approvals. Additionally, no structure or improvement which is the subject of this Agreement may be constructed until any necessary land use approvals and/or variances have first been obtained. g. No Interest in Land. Neither the provisions nor its recording among the land records shall be deemed to create any interest of the Developer in the Public Areas; but rather shall be construed as merely giving Developer the permission to occupy and utilize the Public Areas consistent with provisions and limitations of this Agreement. h. Recording This agreement will be recorded among the land records, within 60 days of the date hereof, by the Developer who shall pay for the cost of such recording. i. Notices. City: City of Richfield 6700 Portland Avenue S. Richfield, MN 55423 Attn: Developer: NOVO, LLC 3601 18th Street South, #103 St. Cloud, MN 56301 j. Severability. If any provision of this Agreement is invalid or unenforceable, such provision, if feasible, shall be deemed to be modified to be within the limits of enforceability or validity; if, however, the offending provision cannot be so modified, it shall be stricken and all other provisions of this Agreement in all other respects shall remain valid and enforceable. k. Entire Agreement, Amendment: This Agreement, including the exhibits, contains the entire agreement between the parties pertaining to the subject matter hereof and fully supersedes all prior written or oral agreements and understandings between the parties pertaining to such subject matter. This Agreement shall not be modified, amended, supplemented or revised, except by a written document signed by the parties. 1. Exhibits. All exhibits revered to in and attached to this Agreement are incorporated and made a part of this Agreement. M. Counterpart Signatures. This Agreement may be executed simultaneously in two of more counterparts, each of which shall be deemed original, and all of which shall constitute one and the same instrument. 29370-001/Doc. No. 285661 5 CITY: CITY OF RICHFIELD, A municipal corporation By: Its Mayor By: Its City Manager The foregoing instrument was acknowledged before me this _ day of , 20 , by and , the Mayor and City Manager respectively, of the City of Richfield, a Minnesota municipal corporation, on behalf of the municipal corporation. Notary Public 501 DEVELOPER: NOVO, LLC a Minnesota 1 Its: J o(9(;tji STATE OF MINNESOTA COUNTY Ok< j &} The foregoing instrument was acknowledged before me this day of V' , 20 19 , by j7e ��-e-q )-)i'yWrl the rpr&CjP "t of NOVO, LLC, a Minnesota limited liab' ity company. �L-0ytjL ' . RY PUBLIC SUMMER LDFORRESTNOTARY PUBMy Comm. Ex THIS INSTRUMENT WAS DRAFTED BY: City of Richfield 6700 Portland Avenue Richfield, MN 55423 Page 7 of 12 EXHIBIT A Lot 1, Block 1, NOVO HENNEPIN COUNTY, MINNESOTA Page 8 of 12 EXHIBIT B Civil Plans prepared by Bogart Pederson & Associates, Inc. dated November 8, 2019. Specific plan sheets outlined below: ■ Sheet No. C4.0 -- Utility Plan ■ Sheet No. C5.0, C5.1, C5.2, C5.3, C5.4 — Grading & Erosion Control Plan ■ Sheet No. C6.0 — SWPPP Narrative EXHIBIT C Page 9 of 12 Civil Plans prepared by Bogart Pederson & Associates, Inc. dated November 8, 20M Specific plan sheets outlined below: ■ Sheet No. C2.0 — Site Plan ■ Sheet No. L1.0 — Landscaping Plan Page 10 of 12 co C a) E cn a QE a) G > 0 r+ O Z L K — f0 a) W O U) U Co L Co � _N d N 0 U i C C 0 c0 a) +J C U 'O () _0 a) ' a) O 0 -0-0-0 a) () a) 'a O 'U a) a) U -0 a)) -D U O >, >, �° >, -O -0 -0 0 a aa) aa)) CD aa)) aa) a)) ca m a)) a°) a)ca c c c c c c c c c c c c c — (n Q cn Q rn Q to Q rn Q to Q to Q c Q c Q c Q 0 Q to Q cn Q 4�od () L a) c C —O (n O (C0 0- V22oCa a O) ca 0) 0) a a a 0_a) o 0 cc 00 O O OaM> > >> > >>0 a) 0 0 0 Uln 000 0 0 ai c UQ) v c � LD N'O O M C CE 0> O _� cu c C" �a�0a)ca.OEa)ccEcoE C" 0" C a) O) cu () 0) () a) O�Qyo��c°io���a) cu a 00 D. 0 0 >-S CL > 0�,� _ a) > > _A > >, > _T 0 E V N 0 E� Ci � i� cn 0 0 0 0 C) Ci 0 C = a a a CL CL a a a a a) a) N (p m 0 0 O O O O O O O O O O O C cn C O(D a) � Q a) N a) N N a) a) N N a) N a) N (j 0 0 O Z 0 C 0 0 0 0 0 cc L O CL a) Q. a) O. a) a O O O o c >' ' O U U � UU a>) 000 a>) a>> 0 U a>) 0 0 UU 0 Y a�i Y U) Y 3 3 cin O a) `0 ca `0 o 5 a) Q m 3 Fu 3 m P:2> m m o" -v)"� w v) �� �; a) co a) a) cn cn o 0 0 02 OLLfn fn N N O f0 .. > N C +�+ U a) _ � E � E E N C cu > (OA U) N 0 co E fn L U) L O -0 C f0 > 'U O a) Q a) C 0) += L + + a) � () (Ci (O C Co•L a) (n C N C >, L a) ++ O w ww co cocA—iaacnD u)D �n,xF-a.�cnm EXHIBIT E SKETCH OF PROPOSED SIDEWALK EASEMENT/ BROADWAY rNVESTC 9t LLC PAFR OF MOTION 29. T. 2!. R 24 ORV OF RICHFIELD, HENNEPIN OOUMT, MINNEEOTA Nw awex L__L __L_� 01 MVo I tl fr-u�wA1•I !E -':r SN.f.-! ■ •!.'„ I,ORIII lhr • I I I r NaniKlmlro a g lie,WB .P l.r t toot 4 MOro for wW { ly II � IrI .e7� ` I ^� wlEr V ° c�ro '�e I — �__ — 9A.n Msvi77•i 1_ �_ _�--_ _ r�?r lA610 AM 11 t SOUM 1M MOro dxi 4�`f lOrf ap�ORl �t ��iOVIN [11C p; for [ toar 1 ~mcmW;%')Ml p+� AVrO Propmed Sidcwelk E96Clneltl Description - Bmad%m Inworton, LLC : A Skkh d& E-1, aver, under wd upon that pwt o1 Lot I, Block I, 'NOVD� Hennepin Cowty, Mbnwoto, Which Ike We.twly of tM hllowbq Wombed Ike: Carwn.n ng I Ih. Nwth..sl corner of Lot L Bock I, of dd'NOVO';Thsnc. South 99 d.W— 47 mhnht.e 21 r.cwhd. E." a..um.d beano,, olwh9 the North Ilne at Lot I, Nock I,'NOVO,' a dl.tance of 650 foot, to Point of BsgFnlnp .1 th. IM to b. "r 6 ; Th.— South II op 07 minute. 70 --d. W..R o dkf—. W 35n Mt; Tr. South 00 de9re.. I. m>•Nes SS ..m+d. EwR pwat.h witn the WW Ibh. of Lot I, &aclt R 'NtriD,' a dlstwe. of SID.B7 feel mor. er few to the South Iln. of mid Lot I. Block I, and these bonketln9. Note: Th. plot of Naw has bean aocpt.d by th. CNy of Richfield, but not yet r.cordad LEGEND. •� '^ St"'V t RQMTY — — — — AD-"NINO PROPERTY UNE SHEET 1 OF 1 SHEETS PROPOSED SIDEWALK EASEMENT pdr.hy '�o•vir�ox+a A t� r OM SCALE: P-60' vw•wM y es str. y la. AMTES, t ABBD6I11TE8, HIIC. & AS8 REYl5f0!@ �% �'�lihle Oa:7116l LY LIc. No. 23044 DRAW* II.c: K ro0. DL��tr Eaam.at,d.o tff-AFSd Page 12 of 12 AGENDA SECTION:CONSENT CALENDAR AGENDA ITEM #2.G. STAFF RE P ORT NO. 21 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Joe P owers, A ssistant C ity E ngineer D E PA RTME NT D IRE C TO R RE V IE W: K ristin A sher, P ublic Works D irector 1/21/2020 O THE R D E PA RTM E NT RE V IE W: N/A C ITY MA NA G E R RE V IE W: K atie Rodriguez, C ity Manager 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the approval of a Construction and Maintenance Agreement with Chamberlain Apartments, LL C that defines ownership and maintenance responsibilities for certain features constructed at 6630, 6700, and 6701 Richfield Parkway. E X E C UT IV E S UM M ARY: The properties at 6630, 6700, and 6701 Richfield Parkway were redeveloped to construct three multi-unit apartment buildings. The construction includes site improvements on both public and private property. T he City has worked with the Developer to draft a Construction and Maintenance Agreement that defines ownership and maintenance responsibilities for the site and boulevard improvements constructed during the redevelopment project. T hese improvements and responsibilities include: Sidewalk and Sidewalk Snow Removal Landscaping and I rrigation Boulevard Trees Street and Sidewalk Lighting Storm water Control Devices I nfiltration Basins RE C O M M E ND E D AC T I O N: By Motion: Approve the Construction and Maintenance Agreement with Chamberlain Apartments, L LC for the site at 6630, 6700, and 6701 Richfield Parkway. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T T he City required the redevelopment to provide storm water quality treatment before storm water enters the City system. T he onsite treatment structure will help remove pollutants and particles before the water enters the public system. In order for the treatment structure to function as designed, it must be inspected and cleaned regularly. Drainage improvements are also being constructed on the site and include four infiltration basins which infiltrate storm water on the property and temporarily store storm water during larger storm events before delivering it to the public system. In order for the infiltration basins to function as designed, they must be inspected and maintained regularly. The Agreement provides direction on inspection, repair, replacement, and maintenance of the treatment structure, infiltration basins, and the public improvements, in addition to the remedies for the failure to comply with the provisions of this agreement. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): The City requires a Construction and Maintenance Agreement for redevelopment projects containing boulevard improvements and/or storm water treatment structures. C.C R IT IC AL T IMIN G IS S U E S: No critical timing issues are identified. D.F IN AN C IAL IMPAC T: The Agreement requires the property owner to cover all costs related to inspection and maintenance of the infiltration basins and the storm water treatment structure. The Agreement requires the property owner to reimburse the City for any costs incurred in performing activities identified as the responsibility of the property owner. Financial responsibilities of other items varies per the agreement. E.L E GAL C ON S ID E R AT ION: The City Attorney was consulted during the negotiations of terms and has reviewed the agreement. ALTE R N AT IV E R E C O MME N D ATIO N(S): None P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: None AT TAC H ME N T S: D escription Type C hamberlain Maintenance A greement C ontract/A greement Chamberlain DRAFT 12/20/19 MAINTENANCE AGREEMENT � This agreement, made and entered into as of the 15 tA day ofd/�, 20A0 by and between Chamberlain Apartments, LLC, a Delaware limited liability chpany ("Developer") and the City of Richfield, Minnesota, a Minnesota municipal corporation ("City, Recitals 1. Developer is the owner of a certain tract and parcel of land lying within the City on land legally described in the attached Exhibit A ("Property"). 2. The Developer has undertaken the construction of buildings and related site improvements ("Site Improvements") on the Property. 3. The City has granted approval to Developer to construct certain storm drainage improvements on the Property, which drainage improvements drain into the City's storm sewer system ("Public System"). 4. The drainage improvements include four (4) infiltration basins and one (1) underground StormTech system ("Drainage Improvements") constructed by Developer that will treat storm water before it enters the Public System. The Drainage Improvements are designed to remove sand, gravel and other particles from the storm water passing through the Property prior to entry into the Public System. The plans and specifications for the Drainage Improvements, and a site plan showing its location on the Property are contained in the attached Exhibit B ("Drainage Improvement Plans"). 5. In order for the Drainage Improvements to function as designed, they must be inspected and maintained routinely. 6. In conjunction with the construction of the Site Improvements, certain improvements and betterments ("Public Area Improvements") have been constructed on portions of the City right-o&way and public easements abutting the Property (collectively, the "Public Areas"). The Public Area Improvements are described and located on the site pIan attached as Exhibit C. 7. The parties are desirous of entering into this Agreement for the purpose of providing the basis for the repair, replacement and maintenance of the Drainage Improvements and the Public Area Improvements and setting forth the remedies for failure to comply with the provisions of this Agreement. 609953v2 RC I GO-4 1 Chamberlain Agreement For good and valuable consideration, the receipt and sufficiency of which the parties acknowledge, the parties agree as follows: 1. Draina eg_ Improvements. Design and Construction. The Developer shall construct and pay for the cost of construction of the Drainage Improvements. Plans and Specifications for the Drainage Improvements were reviewed and approved by the City prior to commencement of construction. 2. Draina e Improvements. Inspection and Cleaning. Beginning in calendar year 2020, the Developer shall be responsible for inspecting and cleaning the Drainage Improvements at intervals of not less than once every 12 months, and more often as requested by either party. The Developer shall provide the City with an annual report documenting the inspection and maintenance of the Drainage Improvements on or before December 31 of each calendar year. 3. Drainage Improvements. Right of Access. The Developer -grants to the City, its agents and employees the right to enter onto the Property to conduct periodic inspections, and if the Developer defaults in its responsibilities after notice and failure to cure as described in Section 7.c of this Agreement, the City may perform such cleanings, repairs and replacements, at the cost of the Developer. The City agrees that it will not unreasonably interfere with the Developer's use of the Property. At the request of the Developer, the area affected by this right of access shall be legally described and recorded as a supplemental agreement all at Developer's sole cost and expense. 4. Public Area Improvements. _Construction, Installation, Maintenance, Repair and Replacement. The parties agree to undertake the responsibilities for the construction, installation, maintenance, repair and replacement of Public Area Improvements, and the intervals for the doing of such work that are described in Exhibit D. In addition to the foregoing, the City will provide basic snow removal on the public sidewalks and Three Rivers Park Trail in the Public Areas. If the Developer desires additional removal or treatment, it may provide these services at its own expense. Any such additional removal is subject to the requirements of Paragraphs 5 and 7 b. Sidewalk damage, or damage to adjacent areas, due to the use of heavy equipment, excessive salt/chemical, and/or any other damage caused by the Developer will be repaired by Developer at the Developer's cost, and, such work is subject to the provisions of Paragraphs 5 and 7 b, and the cure provisions contained in Paragraph 7 c. Developer shall not apply salt to the Three Rivers Park Trail. All other work shall be performed in accordance with the terms of Exhibit D to this agreement. 5. Public Area Improvements. Right of Access. Subject to compliance with any preconditions contained in the City Code, the City grants to the Developer, its agents and employees the right to enter onto the Public Areas to perform the work required to be performed by the Developer pursuant to Paragraph 4. The Developer agrees that it will not interfere with the public use of the Public Areas. The Developer will notify the City and 609953v2RC 160-4 2 Chamberlain any other agency having jurisdiction over, or an interest in, the Public Areas or abutting streets and highways at least 48 hours in advance of any scheduled work; and will comply with any reasonable requirements of the City or such other agency governing signage and other regulations governing work in the Public Areas including, without limitation obtaining any additional permits, licenses or approvals needed for the doing of such work, provided, however, that if the City or other agency refuses or elects not to issue any permit, license or approval required for the work or any portion thereof, Developer shall be released from the obligation to perform such work. Developer grants to the City, its agents and employees, the right to enter onto the Property to maintain the pedestrian sidewalk lighting as identified in Exhibit D. 6. Public Area Improvements. Ownershiu. Exhibit D designates the Public Area Improvements which are to be constructed by Developer and conveyed to the City following the City inspection of the work and notification to the Developer that it will accept conveyance. Developer warrants that such conveyance will be free and clear of any mechanic's liens or encumbrances other than Developer's first priority mortgage in favor of its lender. Any warranties available as a result of construction of such Public Area Improvements will be assigned to the City, and, to the extent available, will be utilized to oMet Developer's maintenance obligations hereunder. 7. Miscellaneous Provisions. a. Maintenance repair and replacement obligation. The party having the maintenance, repair or replacement obligation shall have the affirmative obligation of assuring the item to which the obligation attaches is always kept in good, safe, operable and presentable condition. If the City becomes aware of a condition relating to an item for which the Developer is obligated, it shall notify the Developer in writing whereupon the Developer shall promptly inspect, and as needed, maintain, repair or replace the item within 30 days of the date of such notification by the City. b. Insurance, Indemnity. The Developer will, during the teen of this Agreement, maintain commercial general liability insurance in an amount of not less than $2 million dollars per occurrence insuring against claims for injury, death or property damage or death caused by any activities conducted by Developer, its officers agents or employees within the Public Areas; including, without limitation, the failure of Developer, as obligated hereunder, to properly maintain, repair, or replace the Public Area Improvements. The Developer also agrees to indemnify, hold harmless and defend the City, its officers, agents and employees from any third -party claims or causes of action occasioned by or arising out of the Developer's activities or failure to perform activities under this Agreement. The Developer's indemnification obligation shall not extend to claims that are the result of the negligence or the willful misconduct of the City, its officers, agents or employees. The City shall indemnify, defend and hold Developer harmless from any third -party claims or causes of action occasioned by or arising out of the negligence or willful misconduct of the City, its officers, agents or employees. 6099�3v2RC 160-4 3 Chamberlain c. Default. If either party defaults in any of its obligations hereunder, after written notice of such default and failure to cure within 30 days following such notification, unless extended upon mutual agreement of the parties, the non defaulting party may pursue whatever remedies are available at law or in equity. In addition to such remedies, if the Developer is the defaulting party, and the default relates to activities within the Public Areas, the City may, after such notice and cure period perform the work and recover the entire cost of such work against the Developer through direct payment or as a lien against the Property to be collected as a special assessment. The Developer agrees and stipulates that any such work will be for the betterment of the Property, and that the value of the Property will be increased by at least the cost of the work. The Developer for itself, its successors and assigns waives any challenge to the assessment for such work, and waives its right to a hearing and to challenge the assessment after it is levied, except Developer reserves the right to challenge the amount of the assessment if Developer believes, in good faith, that the amount of the assessment exceeds the actual cost of the work incurred by the City. If the City provides written verification that the assessment does not exceed the actual cost of the work, Developer will withdraw its challenge. In addition to placing an assessment lien against the Property, the City may also seek to impose and collect a lien pursuant to Minnesota Statutes, Section 514.67. d. Term. This Agreement shall remain in full force and effect until terminated by the mutual written agreement of the parties. e. Successors and Assigns. This Agreement shall be binding on and inure to the benefit of the parties and their respective successors and assigns. Developer will secure the joinder or consent of any holders of liens or encumbrances on the Property;. f. Other Approvals. This Agreement shall not relieve Developer from the need to obtain all licenses, permits and approvals that are required by the City and other permitting and licensing authorities to allow for the development of the Property. g. No Interest in Land. Neither the provisions of this Agreement nor its recording among the land records shall be deemed to create any interest of the Developer in the Public Areas, except as otherwise provided herein. This Agreement only gives the Developer the permission to occupy and utilize the Public Areas consistent with the provisions and limitations of this Agreement. h. Recording. This agreement will be recorded among the land records, within 60 days of the date hereof, by the Developer who shall pay for the cost of such recording. 609953v2RC160-4 4 Chamberlain i. Notices. City: City of Richfield 6700 Portland Avenue S. Richfield, MN 55423 Attn: Developer: Chamberlain Apartments, LLC 501 South 8"' Street Minneapolis, MN 55404 Attn: Peter J. Diessner j. Severability. If any provision of this Agreement is invalid or unenforceable, such provision, if feasible, shall be deemed to be modified to be within the limits of enforceability or validity; if, however, the offending provision cannot be so modified, it shall be stricken and all other provisions of this Agreement in all other respects shall remain valid and enforceable. k. Entire Agreement, Amendment. This Agreement, including the exhibits, contains the entire agreement between the parties pertaining to the subject matter hereof and fully supersedes all prior written or oral agreements and understandings between the parties pertaining to such subject matter. This Agreement shall not be modified, amended, supplemented or revised, except by a written document signed by the parties. 1. Exhibits. All exhibits referred to in and attached to this Agreement are incorporated and made a part of this Agreement. m. Counterpart Signatures. This Agreement may be executed simultaneously in two or more countez�arts, each of which shall be deemed original, and all of which shall constitute one and the same instrument. CITY: CITY OF RICHFIELD, A municipal corporation By: Its Mayor By: Its City Manager 6099�3v2RC I60-4 5 Chamberlain The foregoing instrument was acknowledged before me this _day of , 202 by and , the Mayor and City Manager respectively, of the City of Richfield, a Minnesota municipal corporation, on behalf of the municipal corporation. Notary Public DEVELOPER: CHAMBERLAIN APARTMENTS, LLC Bv: Kraus -Anderson, Incorporated Its: Mana�in� Member Its: President ' *IV The foregoing instrument was acknowledged before me this L day ol OIL; by Peter J. Diessner, the President of Kraus -Anderson, Incorporated, the Managin Member of Chamberlain Apartments, LLC, a Delaware limited liability company, on behalf of the limited liability company. �1 „F;, G09953v2RC160-4 6 Chamberlain EXHIBIT A [See attached.] G09953v2RC 160-4 � CI L_.__WOO __._.—___—� � f I I I _ tL t r ; ! (=SO I t 1 < iI t Iy Ow i t J t. r1 MOO t J ( I I • t Sr — — — — Ism is Ise is I I _ I -J ?�3 1 =3 U (] Chamberlain >IJXHIBIT B [See attached.] 609953v2RC l GO-4 1 � a ale; N lSrd 1.33!l!8 IfL90 I . 1 {4floo f ylgeyd t� � 1i1j Ii u FYI u 1JY. aLJ.ruLJ 40 1 } s y lot. gl i 1 � - j t /I if Z co i li j\`—j a :aas m ttWii m , i 7 7 IF CL £. I o� cz k r, I . ,• �_ �u gl� 5 .4 �y� . f •. rf. .Ll I; I: 1SV3 193&LS 14199'� IF e ! IF Lp to$7iu g����8gs3 p G = & III j� � I tg�•,i 7"}�� y � o t lz III pI`� $s',lLa Fl 1 I � o zra orm n t arut N �1 �3 �a �5 d G� b w C c� ¢ 0 y�F �I '•d s 1 �;�. � � CiCA 1 1 ' ' ! I iS 1 ,t i to ll L L I s •� 4 F�su�ir_eaw"�"- -L33tllS i%LL9r t it 1.b. tt t i 1 g Ito ,Ilk tl ..,s is ;< .1 9 s' t•t:: `' �xd too: g'ac u IF i d it i]-_ It POE } �i e ArrF ♦ i ♦I of r-1 �1 f } !'i 71 fill F I.fl+Jjj ,! jji=!!.tfls(i4 S! I.; it ; i il= t} fii! lit — a ; ! l; _ r iS ;l :: ititt y it ti e Ffi j _ LS� s (, i E tot ' Its ' sif to 41 000� T p F lt� r: L I ! �ff si`S _b�r I_. 6 -!� — `•. tot!lOft f ;1ll' fj IfWoof f f Jr y'li i f i!11 iit��! ! i I1'i} 711kfit iII tii If ll! _ I . tl� ltc, it liil}I�lfHP I ,t }j�Ilitlsj?ij) J I }g o; I Li ; 3 I 48�� f ;t � ^ ' df i I[i }'3 3 ; � if1j t ALI it J'' r 1 I lit u f Chamberlain EXHIBIT C (See attached.] 609953v2RC 160-4 17 1 i E: ►i a��a U �_ aly •� - -- -- 61 1 r Pt �1 A:j 5 iaE ea h S. ;�: yys;i�.Es-e �� 3'?AjQe ?6 a=1%33; •..e` �'i t :� zi �� a'p .=�:Y j e6f€e3is.,S�iap i°� $: ec3�e 3sF'a 5df"+y 5 isf A'S 7 c 3a €=gl; xx2 i�=�s3Ra3�x ._ii2r?F.^.tF.'.:i F3 in �; °e Lf tie aa�9a `r"5ia ,o{€ ?f5 Yiw 9i 41 �1 a v d Bg� W W {ti V � \1 Chamberlain EXHIBIT D Exhibit D 6 330, 6700, 6701 Richfield Parkway — Chamberlain Apartments Public Area Improvements Public Area Ownership Construction Maintenance, Responsible for Inspection & Feature and Installation Repair, the Cost of Maintenance Responsibility Replacement Operation & Cycle Responsibility Maintenance Sidewalk City Developer City City Annually Sidewalk Snow City N/A City City City Removal Three Rivers Park TRPD Developer City City City Trail (TRPD) Snow Removal Landscaping Developer Developer Developer Developer As needed Private Irrigation Developer Developer Developer Developer As needed Public Utilities City Developer City City As needed (Storm, Sewer, Water StormTech System Developer Developer Developer Developer Annually or as required by manufaturer Infiltration Basins Developer Developer Developer Developer Annually 4 Pedestrian City Developer City Developer As needed Sidewalk Lighting Street Lighting City Developer City City As needed Boulevard Trees City Developer City City As needed G09953v2RC I60-4 21 AGENDA SECTION:PROPOSED ORDINANCES AGENDA ITEM #4. STAFF RE P ORT NO. 22 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Matt B rillhart, A ssociate P lanner D E PA RTME NT D IRE C TO R RE V IE W: John S tark, C ommunity D evelopment D irector 1/22/2020 O THE R D E PA RTM E NT RE V IE W: C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider approval of an ordinance rezoning property at 6501 W oodlake Drive (Market Plaza / Village Shores). Consider approval of a resolution granting an amendment to the Market Plaza / Village Shores planned unit development to allow a new building for a bank branch with a drive-up ATM. Consider approval of a resolution granting a subdivision waiver to allow the creation of a separate lot for the proposed building. E X E C UT IV E S UM M ARY: Market Plaza and Village Shores ("Market Plaza"), originally built in 1986, is a mixed-use, residential and commercial development on the northwest corner of Lyndale Avenue and 66th Street. The property was significantly renovated and remodeled between 2016-2018. Civil Site Group ("Applicant") has now submitted plans for a new Chase Bank branch building at the corner, with a drive-up ATM lane in the parking lot. I n addition to their application requesting approval of a major amendment to the Planned Unit Development for Market Plaza, the Applicant is also requesting to rezone the property from Planned Multifamily Residential (P MR) to Planned Mixed Use (P MU). The Comprehensive Plan designates this site and the greater Lyndale Avenue & 66th Street area as "Mixed Use." However, as Market Plaza was developed prior to the creation of a mixed use zoning district, the property has remained zoned P MR over the years. W hile the P MR zoning district does allow for limited commercial uses within Planned Unit Developments, Market Plaza is a true mixed use development with a large shopping center component. W ith the proposed addition of another commercial building, staff believes it is appropriate for the property to be rezoned to a mixed use zoning district in conjunction with this proposal. T he proposed use as a retail bank branch and the building design complies with all zoning code requirements. T he building would be located in place of the current plaza/pergola, with customer entrances accessible from the parking lot and from the public sidewalk. Due to grade differences between the sidewalk and the existing parking lot, the building would sit lower than the sidewalk at the roundabout. To delineate this grade change, the proposal includes a short retaining wall topped by a decorative metal railing. Pedestrian access is maintained via stairs at the corner entrance, and an accessible ramp that lines up with the Lyndale Avenue crosswalk. At the direction of staff and the Planning Commission, an additional pedestrian connection will be added on the west side of the building, providing a more direct route to Market Plaza from the public sidewalk. The Applicant proposes to include a standalone drive-up ATM located northeast of the building, accessed by a "slip lane" within the parking lot. All vehicle access will occur via the existing entrances and parking lot - no new curb cuts are proposed. Between the ATM lane and the public street, the Applicant proposes to build a pocket park/plaza with amenities accessible to the public including attractive landscaping, benches and natural stone seat walls, public art, a bicycle repair station, and space for bicycle parking and/or a future bike share station (to be provided by others). I n the Mixed Use zoning district, drive-up window or teller service is a conditionally permitted use, provided that the conditions outlined in Section 537.05, Subdivision 5 are met. The proposal meets most of these conditions, with the following exceptions: The proposed drive-up ATM does not meet the following requirements: A minimum distance of 500 feet must be maintained between substantially similar uses with drive-up window or teller service (as measured from property line to property line). The proposal is less than 500 feet from a substantially similar use (B MO Harris Bank at 6625 Lyndale Avenue). Measured property line to property line across the roundabout, this distance is just 185 feet. However, B MO Harris Bank is an unusual property in that it shares a single lot with the larger Woodlake Centre office complex. I f measured instead to the B MO Harris bank building, the distance separating the two bank uses is approximately 350 feet, which still falls short of the buffer requirement. Policymakers should consider whether the proximity of the existing B MO Harris Bank alone warrants denial of this proposal. Considerations may also include if an over-concentration of drive-thru uses near the City's main downtown intersection is a concern specific to high-volume fast food uses, or if that concern extends to financial institutions as well. Queuing space for at least four cars (70 feet) shall be provided as measured from the drive-up service window or teller station. Such queuing space shall not interfere with parking spaces or traffic circulation. I n the initial plan submittal, the proposal included a much larger drive-thru loop that met the queuing requirement, but did not meet other requirements, nor did it allow for any plaza space. W ith staff's feedback, the loop was replaced with the proposed ATM "slip lane" that is farther from the public street and allowed for the proposed plaza amenities to be added. By code, this queuing requirement applies equally to all drive-thru uses, including fast-food restaurants that are likely to have longer average dwell times per customer than an ATM. Staff finds that it is reasonable to allow a shorter queuing distance for an ATM than other, more intense drive-thru uses. The remaining 12 (of 14) conditions to allow a drive-up facility are met, as detailed in an attached document discussing all P UD/C UP code requirements. Planned Unit Developments may offer flexibility to code requirements in exchange for superior building design and innovative/efficient use of land. T he proposed drive-up AT M has been designed to minimize negative impact to the existing site and to public infrastructure. T he addition of a well-designed building with active street frontage and the pocket park amenity are a significant improvement over the existing parking lot plaza. Engineering staff have reviewed the proposal and do not anticipate any adverse impacts. Finding that requirements to grant an amendment are met, staff recommends approval. T he Planning Commission held a public hearing for the rezoning and proposed development on December 9. T he Planning Commission voted unanimously to recommend approval of rezoning the property to P MU, and voted (4-2) to recommend approval of the development plans for the corner. RE C O M M E ND E D AC T I O N: By motion: 1. Approve an ordinance amending Appendix I of the Richfield City Code to change the zoning designation of property at 6501 Woodlake Drive (Market Plaza / Village Shores) from Planned Multi-Family Residential (P MR) to Planned Mixed Use (P MU). 2. Approve a resolution amending the Planned Unit Development, Conditional Use Permit, and Final Development Plan for Market Plaza / Village Shores. 3. Approve a resolution granting a subdivision waiver to allow the creation of a separate lot for the proposed building. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T Market Plaza / Village Shores was originally approved in 1984, and construction was completed in 1986. I n 2016, the City Council approved an amendment to the Planned Unit Development, allowing the property to make major renovations including the addition of a medical clinic, assisted living units, and resident amenity spaces. Modifications to the building exterior included improved facades, removal of dated building embellishments, and an updated color scheme. The corner plaza and pergolas were added to the property as part of the renovation. At the time, staff urged the property owner to consider eliminating the surplus parking in this area in favor of either permanent quasi-public space or an additional retail building at the corner to activate this key downtown intersection. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): Rezoning: The comprehensive plan designates this site and the greater downtown / Lyndale Avenue & 66th Street area as "Mixed Use". However, as Market Plaza was developed prior to the creation of a Mixed Use designation or zoning district, the property has remained zoned P MR. State Statutes require that zoning designations match the comprehensive plan, and staff felt it was appropriate for the property to be rezoned in conjunction with this proposal. Absent this application, the property would likely be rezoned later in 2020 as City staff works to update zoning designations citywide to bring zoning designations into conformance with the comprehensive plan. Planned Unit Development / Conditional Use Permit / Final Development Plan: There are a number of sets of review criteria that apply to this proposal. A full discussion of all requirements is included as an attachment to this report, in addition to the specific drive-thru conditions (Section 537.05, Subdivision 5) discussed in the Executive Summary. Subdivision: The Applicant requests approval of a Subdivision W aiver to allow the creation of an outlot for the proposed bank building. Finding that the requirements in City Code Section 500 are met, staff recommends approval of the attached Subdivision Resolution. I f approved by the City Council, the Applicant would file a Registered Land Survey with the Hennepin County Surveyor to effectuate the subdivision of property. C.C R IT IC AL T IMIN G IS S U E S: 60-D AY RUL E : The 60-day clock 'started' when a complete application was received on November 29, 2019. Due to the long gap between the Planning Commission meeting and City Council consideration, staff informed the applicant that the City was extending the timeline for a decision by 30 days. A decision is required by February 27, 2020, or the Council must notify the applicant that it is extending the deadline for issuing a decision (up to a maximum of 30 additional days or 120 days total). D.F IN AN C IAL IMPAC T: None. E.L E GAL C ON S ID E R AT ION: A public hearing was held before the Planning Commission on December 9. Notice of the public hearing was mailed to properties within 350 feet of the proposed development and published in the Sun Current newspaper. The Planning Commission voted unanimously to recommend approval of rezoning the property to P MU, and voted (4-2) to recommend approval of the development plans. The City Council approved a first reading of rezoning the property on J anuary 14. ALTE R N AT IV E R E C O MME N D ATIO N(S): Staff recommends approval of the rezoning and subdivision requests. Regarding the P UD amendment, staff provides the following alternative recommendations: Approve the attached resolution with additional/modified stipulations. Deny the request with a finding that Code requirements are not met. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: David Knable, Civil Site Group (applicant on behalf of owner) AT TAC H ME N T S: D escription Type Ordinance - rezone P MR to P M U Ordinance Resolution - A mend P UD Resolution L etter Resolution - subdivision Resolution L etter Requirements attachment B ackup Material Zoning maps B ackup Material D eveloper narrative B ackup Material 3D Renderings B ackup Material S ite plans 1 of 2 B ackup Material S ite plans 2 of 2 B ackup Material Registered L and S urvey B ackup Material E xterior elevations B ackup Material ORDINANCE NO. AN ORDINANCE RELATING TO ZONING; AMENDING APPENDIX I TO THE RICHFIELD CITY CODE BY REZONING LAND AT THE NORTHWEST CORNER OF 66TH STREET AND LYNDALE AVENUE AS PLANNED MIXED USE THE CITY OF RICHFIELD DOES ORDAIN: Section 1. Section 8 of Appendix 1 of the Richfield Zoning Code (Planned Mixed Use) is amended to add a new Paragraph 9 to read as follows: (9) M-3 (NW corner, 66th and Lyndale): Registered Land Survey Nos. 1635 and 1864. Sec. 2. Section 9, Paragraph 3 (Planned Multiple Residential) is amended to read as follows: (3) M-3 (Woodlake Point Condominiums): CONDOMINIUM NO. 0533 WOODLAKE POINT (3) M-3 (NW corner, 66th and Lyndale). Tract 1: All that part of the following described premises lying easterly of the center line of Graham Avenue as deeded to Richfield in Deed recorded in Book 2052 of Deeds, page 639; that part of Government Lot 2 described as beginning at the intersection of the center line of 66th Street with the westerly line of Government Lot 2, which is the old Military Reservation line; thence northwesterly 114.6 feet along the said Military Reservation line to Judicial Landmark No. 11 set pursuant to Torrens Case No. A-2547; thence north along a line extended to Judicial Landmark No. 9 set pursuant to Torrens Case No. A-2547 to the intersection of said line with the southerly line of 65th Street, which is the southerly line of premises conveyed to the Village of Richfield in Deed recorded in Book 2053 of Deeds, page 131; thence northeasterly along the southerly line of 65th Street, which is the southerly line of the premises conveyed to the Village of Richfield in said deed to the east line of Government Lot 2; thence south along the east line of Government Lot 2 to the center line of 66th Street; thence westerly along the center line of 66th Street to the place of beginning; all in Section 28, Township 29, Range 24, according to the recorded plat thereof, and situated in Hennepin County, Minnesota. (See Reference #2 of attached Boundary Conflicts). Tract 2: That part of Government Lot 1, Section 27, Township 28, Range 24, described as beginning at the southwest corner of said Government Lot 1; thence east along the south line of said Government Lot 1 a distance of 64.8 feet; thence north, parallel with the west line of said Government Lot 1 and its extension north, to the southerly line of R.L.S. No. 1318, Files of the Registrar of Titles, County of Hennepin; thence southwesterly along the southerly line of said R.L.S. No. 1318 to the west line of said government Lot 1; thence south along said west line to the point of beginning, and situated in Hennepin County, Minnesota. Tract 3: That part of Government Lot 1, Section 27, Township 28, Range 24, described as beginning at a point on the south line of said Government Lot 2 distant 64.8 feet east from the southwest corner of said Government Lot 1; thence east along said south line a distance of 88 feet; thence north, parallel with the west line of said Government Lot 1 and its extension north, to the southerly line of R.L.S. No. 1318, Files of the Registrar of Titles, County of Hennepin; thence southwesterly along the southerly line of said R.L.S. No. 1318 to its intersection with a line drawn north, parallel with the west line of said Government Lot 1 and its extension north, from the point of beginning; thence south along the last described parallel line to the point of beginning. That the east boundary line of said tract has been judicially determine and Judicial Landmarks set pursuant to Torrens Case No. 17641, and situated in Hennepin County, Minnesota. Tract 4, Parcel 1: That part of Government Lot 1, Section 27, Township 28, Range 24, commencing at a point, which point is marked by Judicial Landmark, and is located 256.6 feet east and 33 feet north of the southwest corner of Government Lot 1; thence north parallel with west line of said line of said Lot 90.7 feet to a point marked by Judicial Landmark; thence at right angles East 229.2 feet to the point of intersection with the westerly line of Lyndale Avenue, which point is marked by Judicial Landmark; thence southwesterly along said line of Lyndale Avenue 95.5 feet to the point of intersection with the north line of 66th Street, which point is marked by Judicial Landmark; thence west along said line 195.7 feet to the point of beginning. Tract 4, Parcel 2: That part of Government Lot 1, Section 27, Township 28, Range 24, described as beginning at a point in the south line of said Government Lot; distant of 152.80 feet east of the southwest corner of said Government Lot 1; thence easterly along the south line of said Government Lot 1 a distance of 103.80 feet; thence northerly parallel with the west line of said Government Lot 1, a distance of 229.60 feet; thence at a right angle westerly 2.20 feet; thence northerly deflecting to the right 89 degrees 38 minutes a distance of 104.07 feet to the southerly line of R.L.S. No. 1318; files of Registrar of Titles; County of Hennepin; thence westerly along last said southerly line to an intersection with a line drawn northerly from the point of beginning and parallel with the west line of said Government Lot 1; thence southerly along last said parallel line to the point of beginning. That the east line of said tract has been judicially determined and marked by Judicial Landmarks set pursuant to Torrens Case Nos. 10017 and 17641 and west line of said tract has been judicially determined and Judicial Landmarks set pursuant to Torrens Cast No. 17641, according to the Government Survey thereof. Tract 4, Parcel 3: All that part of Government Lot 1, Section 27, Township 28, Range 24, described as follows: Commencing on a line parallel to and 256.6 feet east of the west line of said Section 27 at a point therein which is 123.7 feet north along said line from the south line of said Government Lot 1, which point is marked by a Judicial Landmark; thence north along said parallel line a distance of 105.9 feet; thence east a distance of 306.5 feet, more or less, to an intersection with the westerly line* of Lyndale Avenue, which point of intersection is determined by returning to the point of beginning of said line and continuing north along said parallel line a distance of 103 feet; thence south 82 degrees 56 minutes east 141.7 feet; thence north 82 degrees, 34 minutes east to the west line of Lyndale Avenue; thence southerly along said latter line, 115 feet to said point of termination of the north line of the land now being described; thence southwesterly along the westerly line of Lyndale Avenue a distance of 113.4 feet, more or less, to a Judicial Landmark located in said line at a distance of 95.5 feet northeasterly along said line from a Judicial Landmark placed at the intersection of the westerly line of Lyndale Avenue and the north line of 66th Street; thence west 229.2 feet to the point of beginning, according to the Government Survey thereof. (See Reference #6 of attached Boundary Conflicts). *This reference to the westerly line of Lyndale Avenue appears to be in error, and should be the center line of Lyndale Avenue. However, the Judicial Landmarks referred to later may be on the westerly line. Tract 4, Parcel 4: Tract D, R.L.S. No. 1318, Files of Registrar of Titles, County of Hennepin. Tract 5: That part of Government Lot 1, Section 27, Township 28, Range 24 described as follows: Commencing 229.6 feet north and 256.6 feet east from the southwest corner of Lot 1, thence north 103 feet; thence south 82 degrees 56 minutes east 141.7 feet; thence north 82 degrees, 34 minutes east to center line of Lyndale Avenue, thence southerly along the center line of Lyndale Avenue 115 feet, thence west 306.5 feet to beginning, and situated in Hennepin County, Minnesota. Tract 7: Tracts B and C, R.L.S. No. 1318, Files of Registrar of Titles, County of Hennepin, State of Minnesota. Tract 8: Tract E, R.L.S. No. 1318, Files of Registrar of Titles, County of Hennepin, State of Minnesota. That part of Government Lot 1, Section 27, Township 28, Range 24, described as beginning at a point in the south line of said Government Lot 1, distance 256.6 feet east of the southwest corner of said Government Lot 1; thence northerly parallel with the west line of said Government Lot 1 a distance of 229.60 feet to the point of beginning; thence at a right angle westerly 2.20 feet; thence northerly deflecting to the right 89 degrees 38 minutes, a distance of 104.7 feet to the southerly line of R.L.S. No. 1318, Files of the Registrar of Titles, County of Hennepin; thence easterly along said southerly line of R.L.S. No. 1318, Files of the Registrar of Titles, County of Hennepin, to its intersection with a line drawn northerly from the point of beginning and parallel with the west line of said Government Lot 1, thence southerly along said last parallel line to the point of beginning, according to the Government Survey thereof. The west line of said tract has been judicially determined and marked by Judicial Landmarks set pursuant to Torrens Case No. 17641, and situated in Hennepin County, Minnesota. Sec. 3. This ordinance shall be published and become effective upon the land owner’s submittal of proof of recording a Registered Land Survey with the Hennepin County Surveyor or Examiner of Titles. The City Clerk shall be authorized to revise Section 1 above to reflect the newly issued R.L.S. number(s). The City Clerk shall then publish the ordinance in accordance with Section 3.09 of the Richfield City Charter. Passed by the City Council of the City of Richfield, Minnesota this 28th day of January, 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk RESOLUTION NO. ______ RESOLUTION APPROVING AN AMENDED FINAL DEVELOPMENT PLAN AND CONDITIONAL USE PERMIT FOR A PLANNED UNIT DEVELOPMENT AT 6501 WOODLAKE DRIVE WHEREAS, an application has been filed with the City of Richfield which requests approval of an amended final development plan and conditional use permit to allow an additional retail building with drive-up ATM and associated site changes at the planned unit development commonly known as Market Plaza & Village Shores, located at 6501 Woodlake Drive, on property legally described in the attached Exhibit A; and WHEREAS, the Planning Commission of the City of Richfield held a public hearing and recommended approval of the requested amendment to the final development plan and conditional use permit at its December 9, 2019 meeting; and WHEREAS, notice of the public hearing was mailed to properties within 350 feet of the subject property and published in the Sun-Current on November 28, 2019; and WHEREAS, the City Council finds that while the drive-up ATM would be located less than 500 feet from the drive-thru of a substantially similar use (BMO Harris Bank at Woodlake Centre), that existing drive-thru is not prominently visible from the intersection of Lyndale Avenue and 66th Street, and therefore the addition of the ATM lane would not create a detrimental overconcentration of similar drive-thru uses in this area; and WHEREAS, the requested amendment to the final development plan and conditional use permit meets those requirements necessary for approving a planned unit development as specified in Richfield’s Zoning Code, Section 542.09, Subd. 3 and as detailed in City Council Staff Report No.______; and WHEREAS, the request meets those requirements necessary for approving a conditional use permit as specified in Richfield’s Zoning Code, Section 547.09, Subd. 6 and as detailed in City Council Staff Report No.______; and WHEREAS, the City has fully considered the request for approval of an amended planned unit development, final development plan and conditional use permit; and NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Richfield, Minnesota, as follows: 1. The City Council adopts as its Findings of Fact the WHEREAS clauses set forth above. 2. An amended planned unit development, final development plan and conditional use permit are approved for an additional retail building with drive-up ATM and associated site changes as described in City Council Report No. ___, on the Subject Property legally described above. 3. The approved planned unit development, final development plan and conditional use permit are subject to the following conditions: • A recorded copy of the approved resolution must be submitted to the City prior to the issuance of a building permit. • Where the pedestrian route crosses a parking lot drive aisle, a distinct paving material shall be used. Where parking spaces abut the pedestrian route, car stops shall be used to prevent vehicle encroachment onto the walkway. • West of the building, paved surface shall be reduced to only that which is necessary to facilitate trash pickup and egress from required building exit(s). • An additional walkway shall be added on the west side of the building, connecting the 66th Street sidewalk to the existing walkway on the property. • The extent of the retaining wall and railing along the right-of-way shall be limited to only that which is necessary for public safety, due to grade differences. The final design of the railing requires approval by the Community Development Director prior to issuance of building permits. • Snow storage is prohibited in the Market Plaza parking lot, and on the entire bank outlot property. All surface parking spaces must remain available year round. All walkways and stairways shall be cleared of snow and other debris. • Customer entrances on the north and south façade shall be unlocked and accessible to the public during all business hours. • The proposed public art piece shall be installed within two years of approval. • Easements for cross-access, parking, and signage are required. Proof of recording said easements must be submitted to the City prior to issuance of a certificate of occupancy. • The property owner is responsible for the ongoing maintenance and tending of all landscaping in accordance with approved plans. • All new utility service must be underground. • All utilities must be screened from public view in accordance with Section 544.05. A screening plan is required prior to the issuance of a building permit. • No additional freestanding signage shall be permitted, except for smaller directional signs as necessary. This resolution does not constitute approval of any signs. • Subdivision of the property is required and must be recorded with the County. • The applicant is responsible for obtaining all required permits, compliance with all requirements detailed in the City’s Administrative Review Committee Report dated November 18, 2019 and compliance with all other City and State regulations. • Prior to the issuance of an occupancy permit the developer must submit a surety equal to 125% of the value of any improvements not yet complete. • A maintenance agreement must be executed and approved by the Public Works Director prior to issuance of a Certificate of Occupancy. • As-builts or $7,500 cash escrow must be submitted to the Public Works Department prior to issuance of a final Certificate of Occupancy. • Unless specifically modified by this resolution, all previous conditions of approval remain in place. 4. This amendment to the planned unit development, final development plan and conditional use permit shall expire one year from issuance unless the use for which the permit was granted has commenced, substantial work has been completed or upon written request by the developer, the Council extends the expiration date for an additional period of up to one year, as required by the Zoning Ordinance, Section 547.09, Subd. 9. 5. The planned unit development, final development plan and conditional use permit shall remain in effect for so long as conditions regulating it are observed, and the conditional use permit shall expire if normal operation of the use has been discontinued for 12 or more months, as required by the Zoning Ordinance, Section 547.09, Subd. 10. Adopted by the City Council of the City of Richfield, Minnesota this 28th day of January, 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk EXHIBIT A LEGAL DESCRIPTION Tracts A, B, C, E, F, and G, REGISTERED LAND SURVEY NO. 1635 AND Tracts A & B, REGISTERED LAND SURVEY NO. 1864, Hennepin County, Minnesota RESOLUTION NO. RESOLUTION AUTHORIZING A SUBDIVISION WAIVER FOR MARKET PLAZA AND VILLAGE SHORES AT 6501 WOODLAKE DRIVE WHEREAS, an application has been filed with the City of Richfield which requests approval of a subdivision waiver for the division of property legally described as: Tracts A, B, C, E, F, and G, REGISTERED LAND SURVEY NO. 1635 AND Tracts A & B, REGISTERED LAND SURVEY NO. 1864 WHEREAS, the applicant proposes to re-subdivide the above-described property in a new Registered Land Survey, including several Tracts for the various portions of the existing mixed-use development, and a new Tract for the proposed bank building; and WHEREAS, the City Council finds that compliance with City Code Section 500.05, Subdivision 1 would result in unnecessary hardship and that failure to comply therewith will not interfere with the purposes of the platting regulations of Section 500.01. WHEREAS, the City has fully considered the request for approval for the subdivision waiver; and NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Richfield, Minnesota, as follows: 1. A waiver for the subdivision of the property legally described above is hereby granted. 2. City staff is authorized and directed to take any action necessary to effectuate this Resolution and to authorize the recording of conveyances complying with the terms of this Resolution. Adopted by the City Council of the City of Richfield, Minnesota this 28th day of January, 2020. _______________________ Maria Regan Gonzalez, Mayor ATTEST: ___________________________ Elizabeth VanHoose, City Clerk Code Requirements / Required Findings Part 1: The following findings are necessary for approval of a PUD application (542.09 Subd. 3): 1. The proposed development conforms to the goals and objectives of the City’s Comprehensive Plan and any applicable redevelopment plans. The Comprehensive Plan guides the area around 66th Street and Lyndale Avenue for Mixed Use development. Goals and objectives for the area include “continue expansion of the city center area by incorporating residential housing at 50 to 150 units per acre and providing commercial, office and recreational opportunities.” General goals include developing identifiable commercial nodes and corridors, promoting development that broadens the tax base, encouraging shared parking between different developments, and requiring pedestrian connections between land uses. Goals and Policies also include pedestrian/bike-friendly and transit-friendly building and site design features. The proposed additions to the site will improve these conditions. 2. The proposed development is designed in such a manner as to form a desirable and unified environment within its own boundaries. This requirement is met – the proposal repurposes surplus parking space into development that complements the existing buildings and uses on the site. 3. The development is in substantial conformance with the purpose and intent of the guiding district, and departures from the guiding district regulations are justified by the design of the development. The development is in substantial compliance with the intent of the guiding Mixed Use (MU) District. Requested variations to allow the drive-up ATM, discussed in Part 2 #8, are not inconsistent with the Comprehensive Plan. 4. The development will not create an excessive burden on parks, schools, streets or other public facilities and utilities that serve or area proposed to serve the development. The City’s Public Works, Engineering and Recreation Departments have reviewed the proposal and do not anticipate any issues. 5. The development will not have undue adverse impacts on neighboring properties. No undue adverse impacts are anticipated. 6. The terms and conditions proposed to maintain the integrity of the plan are sufficient to protect the public interest. This requirement is met; appropriate stipulations have been incorporated into the final resolution. Part 2: All uses are conditional in Planned Unit Developments, and drive-thrus are conditionally permitted uses (Section 537.05, Subd. 5) in the underlying Mixed Use District. The findings necessary to issue a Conditional Use Permit (CUP) are as follows (Subd. 547.09, Subd. 6): 1. The proposed use is consistent with the goals, policies, and objectives of the City’s Comprehensive Plan. See above – Part 1, #1. 2. The proposed use is consistent with the purposes of the Zoning Code and the purposes of the zoning district in which the applicant intends to locate the proposed use. The proposed building design and proposed use as a retail bank branch complies with all zoning code requirements and with the purposes of the zoning code. The building activates the street frontage with a customer entrance and large windows, as well as a new pocket park/plaza area with amenities available to the public. See #8 below for requirements that are not met by the proposed drive-thru ATM. 3. The proposed use is consistent with any officially adopted redevelopment plans or urban design guidelines. N/A 4. The proposed use is or will be in compliance with the performance standards specified in Section 544 of this code. The proposed development is in substantial compliance with City performance standards. 5. The proposed use will not have undue adverse impacts on governmental facilities, utilities, services, or existing or proposed improvements. The City’s Public Works and Engineering Departments have reviewed the proposal and do not anticipate any adverse impacts. 6. The use will not have undue adverse impacts on the public health, safety, or welfare. Adequate provisions have been made to protect the public health, safety and welfare. 7. There is a public need for such use at the proposed location. See above – Part 1, #1. 8. The proposed use meets or will meet all the specific conditions set by this code for the granting of such conditional use permit. In the Mixed Use zoning district, drive-up window or teller service is a conditionally permitted use, provided that the conditions listed below are met, as outlined in Section 537.05 Subd. 5. A minimum distance of 500 feet must be maintained between substantially similar uses with drive-up window or teller service (as measured from property line to property line). This requirement is not met. The proposal is less than 500 feet from a substantially similar use (BMO Harris Bank at 6625 Lyndale Avenue). Measured property line to property line across the roundabout, this distance is just 185 feet. However, BMO Harris Bank is an unusual property in that it shares a single lot with the larger Woodlake Centre office complex. If measured instead to the BMO Harris bank building, the distance separating the two bank uses is approximately 350 feet, which still falls short of the buffer requirement. Policymakers should consider if an overconcentration of drive-thru uses near the City's main downtown intersection is a concern more specific to fast food uses, or if that concern extends to financial institutions as well. Considerations should also include whether the proximity of the existing BMO Harris Bank alone warrants denial of this proposal. Uses with drive-up window or teller service may not be located adjacent to a property with an existing drive-up window or teller service unless an applicant can demonstrate that the use will not be detrimental to pedestrian, bicycle or vehicle movements This requirement is met. While the property is directly adjacent to a Wendy’s restaurant with drive-thru (6500 Lyndale Avenue), the proposed drive-up ATM will not be detrimental to pedestrian, bicycle or vehicle movements. All vehicle access occurs within the existing parking lot and no new curb cuts are proposed. Separate pedestrian routes are provided throughout the property. No drive-up window or lane shall be adjacent to a public street. While the proposed lane runs parallel to a public street, it is not located between the building and street, nor is it closer to the street than the nearest parking lot drive aisle. Without more specificity in the Code regarding adjacency, it is reasonable to consider this requirement is met, as the drive-thru lane is 26 feet from the nearest property line. Drive-up uses shall be limited to one service window which is part of a primary structure and a single queuing lane. The City may consider one additional service lane for automated teller machines (ATMS) or similar facilities. In this case, the ATM is not part of the structure. However, there is no "primary" teller service window. As the ATM is the only drive-up feature, it is reasonable to consider this requirement met, as the ATM would otherwise be in compliance with this requirement. Drive-up facilities must be designed to minimize impacts to the pedestrian environment and adequately address circulation issues and potential noise or light pollution. This requirement is met. Drive-through canopies and other structures, where present, shall be constructed from the same materials as the primary building and with a similar level of architectural quality and detailing. This requirement is met. There shall be no curb cuts on public streets exclusively for the use of drive-up queuing or exit lanes. Drive-up traffic shall enter and exit from internal circulation drives This requirement is met. Queuing space for at least four cars (70 feet) shall be provided as measured from the drive-up service window or teller station. Such queuing space shall not interfere with parking spaces or traffic circulation. This requirement is not met. In the initial plan submittal, the proposal included a much larger drive-thru loop that met the queuing requirement, but did not meet other requirements nor did it allow for any plaza space. With staff's feedback, the loop was replaced with the proposed ATM "slip lane" that is further from the public street and allowed for the proposed plaza amenities to be added. By code, this queuing requirement applies equally to all drive-thru uses, including fast-food restaurants that are likely to have longer average dwell times per customer than an ATM. Staff finds that it is reasonable to allow a shorter queuing distance for an ATM than other, more intense drive-thru uses. Any drive-up service window, teller or order station, or exterior loudspeaker shall be located at least 150 feet from any parcel with residential uses on the first floor. N/A. The applicant shall demonstrate that such use will not significantly lower the existing level of service on streets and intersections This requirement is met. No new curb cuts are proposed and the proposal is not expected to generate significant amount of traffic. The City shall encourage operators to permit bicyclist use of sales and service windows. This requirement is met. Nothing in the plans would prohibit bicyclist use of the ATM. Alcoholic beverages shall not be served through a drive-up window. N/A. Exterior speakers shall comply with the noise control limits set by Subsection 930 of the City Code. N/A. R R PMR PC-2PC-2 C-2 PMR PC-2 PC-2 MR-3 R PMU R C-2 C-2 PMR PC-2 R R PC-2 PMR PMR PC-2 PC-2 R C-2 PC-2 C-2 C-2 R C-1 R C-2 R R R R R R R R R R R C-2 R R R R R R RR R PC-2 R PMU PMU PMU PC-2 R R PC-2 RRRRRR MR-2 MR-2MR-2 R C-2 R MR-2 R-1 C-2 R C-2 R R PC-2 R C-2 PC-2 RR MR-2 R R ± 6501 Woodlake Dr - APUD 1/2020Surrounding Zoning 0 250 500 750 1,000125FeetPMR - Planned Multi-Family ResidentialPMU - Planned Mixed UseC-2 - General CommercialPC-2 - Planned General CommercialMR-2 - Medium Density ResidentialMR-3 - High Density Residential 350 ft I:\GIS\Community Development\Staff\Planning Tech\Projects\6501 Woodlake Dr - Z.mxd65TH STREETLYNDALE AVE66TH STREET HARRIETGRANDproposed: PMU PRK MIXED MIXEDMIXED MIXED MIXED MIXED MIXED MIXED PRK MIXED MIXED MIXED MIXED MIXED MIXED MIXED MIXED MIXED MIXED PRK MIXED CC MIXED MIXED MIXED MIXED MIXED MIXED MIXED MDRMDR MIXED MIXED LDR MIXED LDR LDR LDR LDR LDR LDR LDR LDRLDR LDR LDR LDR MDRMDR LDRLDR LDR MIXED MIXED LDR MIXED LDRLDRLDRLDRLDRLDR PRK PRK PRK MIXED MIXED MIXED LDR MIXED HDR MIXEDMIXED MIXED MIXED MIXED MIXED LDR LDR MIXED MIXED LDR LDR LDR PRK LDR LDRMIXED MIXED ± 6501 Woodlake Dr - APUD 1/2020Surrounding Comprehensive Plan 0 250 500 750 1,000125FeetMIXED - Mixed UseCC - Community CommercialMDR - Medium Density ResidentialLDR - Low Density ResidentialPRK - Park 350 ft I:\GIS\Community Development\Staff\Planning Tech\Projects\6501 Woodlake Dr - CP.mxd65TH STREETLYNDALE AVE66TH STREET HARRIETGRAND ± 6501 Woodlake Dr - APUD 1/2020Distance to similar (financial) drive-thru 0 125 250 375 50062.5 Feet ~ 1 8 5 ft LYNDALE AVE66TH STREET ~350 ft"imaginary property line" Property Lines"imaginary property line" between Woodlake Centre office and BMO BankProposedChase BankBMO Harris Bank Woodlake Centre www.CivilSiteGroup.com 4931 West 35th Street • Suite 200 • St. Louis Park • Minnesota • 55416 (612) 615-0060 6501 Woodlake Drive, Richfield MN Amended PUD and Subdivision Waiver Application – Project Narrative PID: 2702824230103 November 27, 2019 Project Narrative The property owners of 6501 Woodlake Drive are seeking approval of a Planned Unit Development Amendment and a Subdivision Waiver. The property owner will be subdividing a portion of their property to facilitate the construction of a new bank building and associated parking and landscaping improvements. The property is currently 4.59 acres and will be split into two new tracts. Tract A = 4.16 AC Tract B = 0.43 AC The property is currently zoned PMR - Planned Multi-Family and will be rezoned to PMU - Planned Mixed Use. The anticipated completion date for the project is Fall of 2020. Site Design The proposed site is located in the northwest corner of 66th Street and Lyndale Avenue. The site is currently a parking lot for the Market Plaza Shopping Center. There currently is a grade change between the front entry of the proposed building and the sidewalk in the 66th Street and Lyndale Avenue Right- of-Way. In the current parking configuration, this grade change is accommodated with a retaining wall north of the stalls adjacent to the intersection. To accommodate this grade change with the proposed building, a retaining wall and railing will need to be constructed along the 66th Street and Lyndale Avenue Right-of-Way. This wall and railing will maintain a minimum of three feet of separation between the existing sidewalk to meet City and County requirements. To access the site, an accessible sloped sidewalk will be constructed to the entry off the south side of the building. This sidewalk will line up with the crosswalk on Lyndale Avenue north of 66th Street. The project is requesting the City to allow a drive-up ATM in coordination with the construction of the bank building. The City has indicated that this drive-up ATM would typically not be allowed because the City does not allow drive-thrus adjacent to public streets and also does not allow drive-thrus within 500 feet of similar uses. To mitigate the issues of the proposed drive-thru, the project will be making some concessions to their typical design standards and providing some additional site amenities to benefit the public. The concessions that the project is making is that they are willing to reduce the amount of vehicle stacking that they typically like at their drive-up ATM locations. This reduction will allow the drive-up www.CivilSiteGroup.com 4931 West 35th Street • Suite 200 • St. Louis Park • Minnesota • 55416 (612) 615-0060 ATM location to shift away from the public street and allow room to provide the additional site amenities to benefit the public. The amenities that the project will be constructing to benefit the public include: · Pocket Park with benches. · Space for public art. · Concrete pad to accommodate a future bike share station or bicycle parking. · A bicycle repair station. · Decorative fencing and natural stone piers. · Additional complementary decorative planting beds · Additional landscaping to screen the proposed drive-thru. These additional site amenities will not only help mitigate the construction of the drive-up ATM, but they will also enhance the public experience at the recently upgraded intersection. Architectural Design The design intent of the proposed Chase Bank is to compliment the surrounding architecture of the recently renovated Market Plaza and the newer adjacent commercial developments. The proposed Banking Center is comprised of a thin limestone veneer, aluminum composite panels and fiber cement architectural wall panels that are designed to achieve the refined look of wood. All of the exterior cladding options are modern finishes and are long lasting cladding materials that will mesh well with the development growth of the area. In addition, the floor to ceiling glazing was incorporated to provide connectivity to the retail customers navigating the Plaza and pedestrians traversing the adjacent public thoroughfare. This project will fit in with the character of the neighborhood and will bring a new service to this area. This project should have positive impacts to neighboring properties and will be a benefit to the City of Richfield for years to come. Sincerely, David Knaeble Civil Site Group :Y c-, s !i. NNW t: i •J 4 1 � lAk _ '� �► ;o . /r 4 : 1 y I P4 A.Armijo CHASE A k �`; n i tyr Lf ��' �, �^J� o �1 fl_ � Y. .,s. x .. ,� L., ... , V 4 dlip fee,;i Ina Jima let 777 a le 11 Milo •di rvt rvy'p '�s'r..9dair rcrv+� ARCHITECT: THE ARCHITECTS PARTNERSHIP (TAP) 200 SOUTH MICHIGAN AVE SUITE 1020 CHICAGO, IL 60604 312-583-9800 DEVELOPER / PROPERTY OWNER: E J PLESKO & ASSOCIATES, INC. 6515 GRAND TETON PLAZA, SUITE 300 MADISON, WI 53719 608-833-7600 RICHF1 LD, MINN SOTA ISSUED FOR: CITY SUBMITTAL Garfield Park � 47 trwi S { Y L� Vida VIA name�st L:skewirdS F6bd Ca -up Alchfleld MIS LE r4l aryn Chln W Lyn r}5 WeIN. Farg6' Ban k'p Richtield 5 Lake Park I I 7(finIty Stme Ihy CornCasl a LA Rltiess Pe#tad Michaels � z E I TeIat. I , vl t r000 �' Flrelhflllse Subs p �: PI218 Luce m W 661h 51 w b ah st r aul W 66zl15 t � I s� AQ; iderny of Holy Angels . :..�� IVICLt�rtalfh's f i VE W Posl 5555 1"cm m o ;tir: e-t F':,-'ij, =1 E 679h-tit F2i�i1llplti Dd,Lake a `m W Gffib 0 y'v�111.. .;rL1ii .• a' SITE LOCATION SITE LOCATION MAP N a MASTER LEGEND: --- 1125 EX. V CONTOUR ELEVATION INTERVAL X 1 1 37.1 2 EXISTING SPOT GRADE ELEVATION 1137 1.0' CONTOUR ELEVATION INTERVAL 41.26 SPOT GRADE ELEVATION (GUTTER/FLOW LINE UNLESS OTHERWISE NOTED) 891.00 G SPOT GRADE ELEVATION TOP OF CURB (GUTTER TOP) 891.00 TC SPOT GRADE ELEVATION TOP OF WALL 891.00 BS/TS SPOT GRADE ELEVATION BOTTOM OF WALL —mm— DRAINAGE ARROW ENGINEER / LANDSCAPE ARCHITECT / =000. EMERGENCY OVERFLOW SURVEY: EOF=1135.52 CIVIL SITE GROUP ■■■mmmm■■mmmmmmmmmm■ SILT FENCE / BIOROLL - GRADING LIMIT 4931 W 35TH STREET SUITE 200 no■■ 0 INLET PROTECTION ST LOUIS PARK, MN 55416■■� 612-615-0060 STABILIZED CONSTRUCTION ENTRANCE GEOTECHNICAL ENGINEER: B 1 TBDSOIL BORING LOCATION CURB AND GUTTER (T.0 = TIP OUT) PROPOSED MANHOLE STORM PROPOSED CATCH BASIN OR CATCH BASIN MANHOLE STORM ►/ PROPOSED GATE VALVE 4- PROPOSED FIRE HYDRANT (��;; PROPOSED MANHOLE SANITARY 0 PROPOSED SIGN PROPOSED LIGHT PROPOSED SANITARY SEWER >> PROPOSED STORM SEWER I PROPOSED WATER MAIN > EXISTING SANITARY SEWER >> EXISTING STORM SEWER EXISTING WATER MAIN G G EXISTING GAS MAIN E EXISTING UNDERGROUND ELECTRIC C- EXISTING UNDERGROUND CABLE O EXISTING MANHOLE EXISTING STOPBOX EXISTING LIGHT ❑ EXISTING CATCH BASIN H EXISTING GATE VALVE A EXISTING GAS METER EXISTING HYDRANT X EXISTING ELECTRIC BOX e EXISTING GAS VALVE U0U Know what's below. Call before you dig. SHEETINDEX SHEET NUMBER SHEET TITLE C0.0 TITLE SHEET V1.0 SITE SURVEY C1.0 REMOVALS PLAN C2.0 SITE PLAN C3.0 GRADING PLAN C4.0 UTILITY PLAN C5.0 CIVIL DETAILS C5.1 CIVIL DETAILS C5.2 CIVIL DETAILS L1.0 LANDSCAPE PLAN LT1.0 LIGHTING PLAN SW1.0 SWPPP - EXISTING CONDITIONS SW1.1 SWPPP - PROPOSED CONDITIONS SW1.2 SWPPP - DETAILS SW1.3 SWPPP - NARRATIVE 11/25/2019 8:40:49 AM 0(C �Oly H Ro�e (75]aomr Civil Engineering ^ Surveying ^ Landscape Architecture 4931 W. 35th Street, Suite 200 St. Louis Park, MN 55416 civilsitegroup.com 612-615-0060 LU M CV Nt Q Lo Z2 V Q o Q J J ILL. = N Q U � J Q LU D am Z LU ZLU LU J 0 Z J O 'tLO o) U LU 3 O a ti Z L0 (n z LU 0 � o ga U0 o OM r) W Cn Cn ,a Q W Q CL 0z z O F LLl o ^J z LU co I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONAL ENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA. �:j ) k"Wg-�- David J. Knaeble DATE 1 1 /25/19 LICENSE No. 48776 ISSUE/SUBMITTAL SUMMARY DRAWN BY:BN REVIEWED BY: DK PROJECT NUMBER: 15016.02 REVISION SUMMARY DATE DESCRIPTION TITLE SHEET I iIN " �O 16" P I N I /` a 1, d �\ w .....................,.. / .... .,... a� �N h 11 N ..... ..... ...R. ..� t7i.................. .. ^m '. o� l...'...'.. ..... _ .'' ..... ... .. -.. 0 .. �'.X .. ..... .. .. ..... .. ..... ..... ..................... �'.'.'.'.'.'.'...... 4 .. .':':'... :':':' ' :':':':'...':':':':':':':':':':':':':':':':':':':':':':': :.:.'.'.......:...:.:.:.:... a mac, ...'.'.'.'.'.'.'.'.'.'.'.'.'.'.'.'.'.'.'.'.'.' ' ..'.'.'...'.'.'.'.'.'.'.... rn ...., ..... .... ..... ..... ............................. / r♦ ` ...... ..... ...... .... ..................................'.':.:.;. ° \ 6�.. ... , Y/ Xgp2 ................. f.. , ........... J.'.'.'.'...'.'.'.'.'.'.'.'.'..'..'.'.'.'..'.'.' .'.'.'.'.'.'.'.'.'.'... MM ...... ...... vo \ .... ..... .....� , \...................... /...'.'.'.'.'.'�' ��j�..................'.'...' ' 1 / .... .... . .............. ... ..'.'.'.'.'.... a 1 GV. :�%�- ... .�!'....................................:.:.:. Q .... ..... .o... .....;;, ...... X �,� ... , ... o ...... / }Z...'.'.'.'.'.'. ../. ......... . . . /.. . . .. . . . . . . .Sg . . ....................... h A� �(/ J..... .'.'.'. .............................. .................. ...'.'.':' ::.. .. .. ...: .:'� ::::.:::::..... y(.:::::.:::... .G/���@g_.... ............... ..•. •.•.•.•.•.•......./...'.'.'.'.'.'.......d ° °4 4; ' I .'.'... .'......... / ............... :':'.'.'.','......'.'.' .r................... . ........ ......./...................... �.... ......... ,9. .' ... .. a N a � o a m 13" L C.. M Q ..... c3ti!'............'.'.'.'.'.'.'.'.... .r�1............... ... one �o- vim- .. .. . . .. . . .. . . '. ...... J...a���1 ........................... /. mp .. ....... ...... �� ............."• ........ / ..... ... .. ..................'.'.',/.'.'..........:or.� ............'........... .... .. '0��6.....'.'.'.'.'.'.'.'.'::::.'.'... 1 % .. .. •.•.•.•. •. �q5.�....... .;��y\. .. ......... .. .. .... '.'/ ...'. .tG ....... .. ....... / S SMH .�.'.. .... - - - • ../.... Q. - - - - ..... ° / ..... / ° Rim=845.04 Q /....�... ..... .... r, /` V . . . . ..... . .........'! ..'.'.'.'.'.. . ��e. . . . . . . . ..... ..... .. _ v a'. kkF' . . C_84q C�/-64 \. �\ . I 6q3 +�` . . .. .. . . . V... ..... . .. . ..... ... , 0 b. . . . _ �i'/cB4¢9p ' 4.g4. M B A� T...... 4 C` 6B. .... ... .. .... .. %..... ..... ... ..... .. Vi e4 sf yf.......'.'. /�...'.'�`/ .......... ,o.. ° 3' AP r . a y...... .... ...]J' / .yr ro .'........... Q l.'''''A! '' ' ... ......... a ... .Yr . �1 ...........................'.'.n P° Srh •( Q ... ................� ......... ..y♦ ° ..... ...... ti 1 ts. ag3 B / .... 1y. 9 a° °Q G ..................... _.\..... / 2" ELM .:�................ ..... .... ../' °a o .. Tmil ........... ...... ... ... ...y- . ...89 J .,t. w.� .. oa '� a- ............- ................ / / a ��a Te?7`I+*... a to e .:. ... {R ./9v `1'.'^. .® 0pk Pp .... °. .a d. .. .a aQ ... ... i. ��r d iS� .L0 a. 4 a °. a m Q ..... . t06.......... .' •...•.•. •... 0� ° .... g'L 0 m ........... .. ° 02' MA 'Cites b�j a d d. Q gSs . Q 3" MAP ekk� x�' a .............. ...'(Q da tG' a �.. c 6 a\ r�e�r/� TC,8g846 - C3 1h d as m c a r.....�....°' .'.'.'.'.'.'.'.'.'.' �¢ ...........lr....... cu=saris.. ... ... �.if .. � 845.37 "/ TC=845 54 TC TC-84-� 92 Fi. .... TC= 45.10�=845.52• `� L. v _ _ _ .a 'Pr GU=8�9 GV=B45 OS ....... ° a . Q ....,.,.....'. g4 ...X.... GU-84472.'.'.'.'.'. '.. ° as Q a C a.. ...� O� ✓ �' '`�5 �1 �h � Q �6I '.iCX x . a. ° a `/ a 9 '� / u a Q c d 1 22 .. .. TC 845.90 {G'� a a �ky59 ..'.......'. ....'.......', ... Cll-845.42 ......'.......'.......'. 4 0`� j °/i X........ a ..... ... 0 e �2 S6gO 0 m .....'. �� cG. �`� G�•�� Uj � ..........� �.. ...... N R ..�4;.. ::.. ry ..... GU 846.6 •. • GU=646 47 °° e �� STMH . -846J1 o .. ... ..... TC=84690 Rim�.00 �jTC=846-67 �- << 0 ° < �« << 30 P-- H / _ - - - -<< - - ST - - �� - - - - < 847.1 a °Q d S 29SNI2 �fEL TEL TEL TEL / TEL aEQ a'I a� ♦ -�- 86 GAS GAS TEL TEL ° TELa a_ TEL e a 1� GAS TEL GAS GAs�G.� j� <<s� ° ea�.1:11,16 GA ¢A ---� CAS- e4s.7�s� �- N89030'24"E 87.4 845.96 \ 846.30 i / H - d > a s O,0/ TC=845.83 N89030'24"E 356.60 46 53 0 TC 845.63 'C=846. 2 848,75 TC=B4693 / B ♦ / a��- rr \��o� TC=846. Y♦ Yl / F-I =easss Gu=846.23=646.a2 ° V/ O 8" DIP � 1 .- I V 1 L- (Width Varies) 846.43 847.23 ' 33" RCP PROPOSED DESCRIPTION OF PROPERTY SURVEYED Part of Tract A RLS No. 1864 General Survey Notes 1. Bearings are based on the Hennepin County Coordinate System (1986 Adjustment). 2. Site Address: Unnassigned. 3. This property is contained in Zone X (area determined to be outside the 0.2% annual chance floodplain) per Flood Insurance Rate Map, Community Panel No. 27053C0368F, effective date of November 4, 2016. 4. The Gross land area is 18,601 +/- square feet or 0.427 +/- acres. Total area of Tract A is 199,805 S.F. or 4.587 acres. 5. Elevations are based on the NGVD 29 Datum. Site Benchmark is the to nut hydrant located 15.75 feet south of the southwest property corner, having an elevation of P Y P I Y 9 848.75 feet. As shown hereon. 6. There are 36 total parking stalls on subject property. 7. We have shown the location of utilities to the best of our ability based on observed evidence together with evidence from the following sources: plans obtained from utility companies, plans provided by client, markings by utility companies and other appropriate sources. We have used this information to develop a view of the underground utilities for this site. However, lacking excavation the exact location of underground features cannot be accurately', completely and reliably depicted. 9 9 9 Y, P Y Y P Where additional or more detailed information is required, the client is advised that excavation may be necessary. Also, please note that seasonal conditions may inhibit our ability to visibly observe all the utilities located on the subject property. 8. The names of the adjoining owners of the platted lands, as shown hereon, are based on information obtained from Hennepin County GIS. SURVEY REPORT 11. This map and report was prepared without the benefit of a Commitment for Title Insurance. The legal description was obtained frorn Ramsey County GIS and may not be the legal description of record. Please note that there may be easements or other matters of record that we are unaware of and not shown hereon. 20 10 0 10 20 40 SCALE IN FEET G R t> V P 4931 W. 35TH ST. SUITE 200 ST. LOUIS PARK, MN 55416 CivilSiteGroup.com Z t R ri` 0- 7A E- z w J U I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION .AND THAT I AM A DULY LICENSED LAND SURVEYOR UNDER THE LAWS OF THE STA�QFINNESOTA. RORY L. SrWSTELIEN DATE 11-5-19 LICENSE No. 44565 ^ VICINITY MAP Linetype 91. Symbol Legend m M11N62® W � w® SIGN ❑A AIR CONDITIONER € k Eo FIBER OPTIC SITE Ou UTILITY MANHOLE GASMAIN GAS 0 BOLLARD ' SANITARY MANHOLE C„ WATERMAIN OE ELECTRIC MANHOLE 6 6 W66 ssb, W660S, O > SANITARY SEWER ST) STORM MANHOLE ual.k.o. h Sc 6 >> STORM SEWER ® CATCH BASIN ° FLAG POLE oHu OVERHEAD UTILITIES d ® ROOF DRAIN FLARED END SECTION TEL TELEPHONE LINE GAS VALVE (] TELEPHONE BOX s, ELE ELECTRIC LINE OT TELEPHONE MANHOLE HANDICAP SYMBOL CTv CABLE LINE REVISION SUMMARY x CHAINLINK FENCELINE ® ELECTRIC TRANSFORMER HYDRANT DATE DESCRIPTION WOODEN FENCELINE ® TRAFFIC SIGNAL © WATER MANHOLE O-O- GUARDRAIL © CABLE TV BOX X WATER VALVE CONCRETE SURFACE OE ELECTRICAL METER -0- POWER. POLE I GUY WIRE PAVER SURFACE © GAS METER • FOUND IRON MONUMENT =% CONIFE_ROUS TREE PROJECT NO.: 15016.02 BITUMINOUS SURFACE O SET IRON MONUMENT DECIDUOUS TREE GRAVEL/LANDSCAPE0 PARTIAL BOUNDARY/ CAST IRON MONUMENT TOPOGRAPHIC SURFACE SURVEY 1 Vi 0 ■ ©COPYRIGHT 2019 CIVIL SITE GROUP INC. O O O Civil Engineering ° Surveying ^ Landscape Architecture 4931 W. Street, I 55 200 St. Louisuis Park, MN 55416 v0c,L R♦� $25 S�Si \ civilsitegroup.com 612-615-0060 ♦//// L� II P %Te x B 4ABOT 39N 1 m: 836.1 I Inv8320 B 1 -,N YInv832.2(N) /♦ /// TIi�.26 �` . a�' CBE I i 835. II I B 7.IW / j � ;'t\.�' FFE 1 I I WENDYS e40-8 V\ I Be ♦/// L sr 5 n :� I MH I 834.3 ? I MH I I ' ` 1 I GF BR?m 835.4 I f Inv: 532.7 �I------- ---- L - _ - =TP LG SPK ^ I / I \i g2 ♦ / t \ Be IP I B 6.45E-W L a `\\\ p6 \84 RW-8 RW •4 RW BL THE 4 <s // L.y2-564 1 Be HEIGHT NORMAL LU Cl)/// L SAMH �/ ` / ... AMH M r %� Rim:841.55 / CN ti L� $�5 v:832.35 7 M LO U) FE V\ 7.1 E-W / ./7//FX�i 4..- RAM g�1\+° - _---- �1 Q w O / L E J I- Q _FFE / / - --- ILL _ g GB N N E3 \, EXISTING MARKET - , - 1 Ri :84 0, 5' L1_ O W FF 37. PLAZA BUILDING '' Q v6 C/) Z) 3a. A OLL FFE t z VERIFY DER\Fy < Rim:833.0* Inv:825.12 4O Q O Z Rim:833.14 /L Rim: 44 � / �Z LLO Inv: 828.04 Inv 3�J nv8 U) W I v 125.25* // I '�4 / / i.:`�{' % FL` 6�6 A n ^ ' I I VERIFY �I II / / .r�' +. -�P'L• - - - - - - - - i�� - - - ry W 0 BC ^ \ E /IV: i''Q � � r'.r 11 , Q < \ // i //. / / ./ .< c 4.41N ifRAMN a' C V LO I I (O ELL°.• // I r 2 ° 1 LU Rim:835-8261 .94 I /zis cc 2iNv \VERIFY c < A N FIRE HKUP / � 42 � MH W S e36.0 �� �. 7 844. a q1.s / /645D4 / \ y DCIM OWN 1.3 R3 . 11 aY -' . L ' ,�o;•S. _ � � R 7W RW 4 ry.4.q -Be HEIGHT NORMAL /9d/' - 4�" O / / � / 1 HEREBY CERTIFY THAT THIS PLAN, R"437.7 '`! �� - SPECIFICATION, OR REPORT WAS Q n :832.8 -BC HEIGHT PEAK Be HEIGHT NORMAL 8433 I .�, / _ _ _ _ _ _ �. �. _ / PREPARED BY ME OR UNDER MY DIRECT OF Be \ I ec p SUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONAL ENGINEER - ---- ----- UNDER THE LAWS OF THE STATE OF MINNESOTA. \ I 8445 Be SIGHT NORM, B FFE *L ems' I p .c` r` _ :845. �. David J. Knaeble Ll DATE 11/25/19 LICENSE No. 48776 ISSUE/SUBMITTAL SUMMARY I{� Rim: 841. 5g IT I 'TTIH 11 v ST HIII ®Inv: 0013. IN _-- H n ll �a DATE DESCRIPTION -__ _ _ ----- y t s4 7 _ -- _ _ c ps=...q°. 11/06/19 CITY SUBMITTAL FiR-842.55 4 d , .. - s ❑ 11/25/19 CITY RESUBMITTAL -` - ---- CHAS � POSED RO -_ SITE PLAN LEGEND: E, 45. =946 49 y a 8 '==�-�- -- - - o $ _ _ 46,6 �= LWB ANK BUILDING 43.52 _ 6 H S T LWB / LIGHT DUTY BITUMINOUS PAVEMENT. SEE 66TH STREET WEST L GEOTECHNICAL REPORT FOR AGGREGATE BASE & ----_ °"M AMH / WEAR COURSE DEPTH, SEE DEATIL. CONCRETE PAVEMENT AS SPECIFIED (PAD OR WALK) ®SAMH _ ---- -------------------- Eg SEE GEOTECHNICAL REPORT FOR AGGREGATE BASE --------- ------------- L & CONCRETE DEPTHS, SEE DETAIL. ----------------- / ° - - PROPERTY LINE M M M M M CONSTRUCTION LIMITS o CURB AND GUTTER -SEE NOTES (T.O.) TIP OUT GUTTER WHERE APPLICABLE -SEE PLAN • �\ o DRAWN BY:BN REVIEWED BY: DK TE PROJECT NUMBER: 15016.02 t t* TRAFFIC DIRECTIONAL ARROW PAVEMENT MARKINGS REVISION SUMMARY DATE DESCRIPTION SIGN AND POST ASSEMBLY. SHOP DRAWINGS REQUIRED. HC = ACCESSIBLE SIGN NP = NO PARKING FIRE LANE ST = STOP CP = COMPACT CAR PARKING ONLY OVERALL SITE PLAN a� N Know what's below. 1" = 40'-0" Call before you dig. 161611��� C201 20'-0" 0 40'-011 12/3/2019 8:17:54 AM © COPYRIGHT CIVIL SITE GROUP INC. I I I I TRACT I A I 1V VE EXISTI I � CONC ETAI I 8A CG. 6 \ \ \ LL CL\ 3g66 . \rc\ 3,S 7S & tl 26 I RR`i2 8R'�a 8, A, G� 6 A69 6 R R E STING ( a. AND RO ''BALL, TYP. \845� o0 I Bk5 _ I U=84b.41 TC=845.37 n I GU=B� 9 y6l �L - x �k5. I / IC) n 0 i PA\Y,�MENT F DEP ,TYP. \J JJ JJ JJ JJ J �9 \cp c v JG REM E EXISTING CURB AND GUTTER, TYP./\ ^ ^ / / 16" PIN ti v \ 1/ H❑ /y g7Z� - -U Ci w Q / ^ n CONSTRUCTION LIMA; a 4 r0 a / h /441 /4 1 I / ^ 0 " ^ m REM TING TREE /l rX-.L Bt04TYP. CUT EMENT FULL H, TYP. / it � \t�MOVE NG SIG TYP. m TING FIBER OPTIC LIN FIELD LOCATE DU ING CONSTRUCTION 5 PROTECT FROM AGE \ Ph REMOVE E STIV� -- �' BPS vt I I c5 vvUw S6 I OVERHE I�HT : ° e i��y E ARE F AND Cf �l ' 90?So AND H HOLE �� N �' ' . �0 - G�,Sk65 rt°% 6 / 20 O . SI 180-2 MA NOW i 0,I�I ,'' ro FORK / I J REMOVAL NOTES: 1. SEE STORM WATER POLLUTION PREVENTION PLAN (SWPPP) PLAN FOR CONSTRUCTION STORM WATER MANAGEMENT PLAN. 2. REMOVAL OF MATERIALS NOTED ON THE DRAWINGS SHALL BE IN ACCORDANCE WITH MNDOT, STATE AND LOCAL REGULATIONS. 3. REMOVAL OF PRIVATE UTILITIES SHALL BE COORDINATED WITH UTILITY OWNER PRIOR TO CONSTRUCTION ACTIVITIES. 4. EXISTING PAVEMENTS SHALL BE SAWCUT IN LOCATIONS AS SHOWN ON THE DRAWINGS OR THE NEAREST JOINT FOR PROPOSED PAVEMENT CONNECTIONS. 5. REMOVED MATERIALS SHALL BE DISPOSED OF TO A LEGAL OFF -SITE LOCATION AND IN ACCORDANCE WITH STATE AND LOCAL REGULATIONS. 6. ABANDON, REMOVAL, CONNECTION, AND PROTECTION NOTES SHOWN ON THE DRAWINGS ARE APPROXIMATE. COORDINATE WITH PROPOSED PLANS. 7. EXISTING ON -SITE FEATURES NOT NOTED FOR REMOVAL SHALL BE PROTECTED THROUGHOUT THE DURATION OF THE CONTRACT. 8. PROPERTY LINES SHALL BE CONSIDERED GENERAL CONSTRUCTION LIMITS UNLESS OTHERWISE NOTED ON THE DRAWINGS. WORK WITHIN THE GENERAL CONSTRUCTION LIMITS SHALL INCLUDE STAGING, DEMOLITION AND CLEAN-UP OPERATIONS AS WELL AS CONSTRUCTION SHOWN ON THE DRAWINGS. 9. MINOR WORK OUTSIDE OF THE GENERAL CONSTRUCTION LIMITS SHALL BE ALLOWED AS SHOWN ON THE PLAN AND PER CITY REQUIREMENTS. 10. DAMAGE BEYOND THE PROPERTY LIMITS CAUSED BY CONSTRUCTION ACTIVITY SHALL BE REPAIRED IN A MANNER APPROVED BY THE ENGINEER/LANDSCAPE ARCHITECT OR IN ACCORDANCE WITH THE CITY. 11. PROPOSED WORK (BUILDING AND CIVIL) SHALL NOT DISTURB EXISTING UTILITIES UNLESS OTHERWISE SHOWN ON THE DRAWINGS AND APPROVED BY THE CITY PRIOR TO CONSTRUCTION. 12. SITE SECURITY MAY BE NECESSARY AND PROVIDED IN A MANNER TO PROHIBIT VANDALISM, AND THEFT, DURING AND AFTER NORMAL WORK HOURS, THROUGHOUT THE DURATION OF THE CONTRACT. SECURITY MATERIALS SHALL BE IN ACCORDANCE WITH THE CITY. 13. VEHICULAR ACCESS TO THE SITE SHALL BE MAINTAINED FOR DELIVERY AND INSPECTION ACCESS DURING NORMAL OPERATING HOURS. AT NO POINT THROUGHOUT THE DURATION OF THE CONTRACT SHALL CIRCULATION OF ADJACENT STREETS BE BLOCKED WITHOUT APPROVAL BY THE CITY PRIOR TO CONSTRUCTION ACTIVITIES. 14. ALL TRAFFIC CONTROLS SHALL BE PROVIDED AND ESTABLISHED PER THE REQUIREMENTS OF THE MINNESOTA MANUAL ON UNIFORM TRAFFIC CONTROL DEVICES (MMUTCD) AND THE CITY. THIS SHALL INCLUDE, BUT NOT BE LIMITED TO, SIGNAGE, BARRICADES, FLASHERS, AND FLAGGERS AS NEEDED. ALL PUBLIC STREETS SHALL REMAIN OPEN TO TRAFFIC AT ALL TIMES. NO ROAD CLOSURES SHALL BE PERMITTED WITHOUT APPROVAL BY THE CITY. 15. SHORING FOR BUILDING EXCAVATION MAY BE USED AT THE DISCRETION OF THE CONTRACTOR AND AS APPROVED BY THE OWNERS REPRESENTATIVE AND THE CITY PRIOR TO CONSTRUCTION ACTIVITIES. 16. STAGING, DEMOLITION, AND CLEAN-UP AREAS SHALL BE WITHIN THE PROPERTY LIMITS AS SHOWN ON THE DRAWINGS AND MAINTAINED IN A MANNER AS REQUIRED BY THE CITY. CITY OF RICHFIELD REMOVAL NOTES: 1. RESERVED FOR CITY SPECIFIC REMOVAL NOTES. EROSION CONTROL NOTES: SEE SWPPP ON SHEETS SW1.0-SW1.3 sTM 6i _ _ - _ - 26 ST TC= 46. 0 u / .1I _ _ - I PROTECT rXISTING ° = ,�?" e e 846.86 XISTIN-�,-& $k66� ��/ 847.16 \ J 846.5o I*,TYP. (BUTTE F N89 3Q-1'�4 E 87.41 4 .. 846.95 i p n 845.96c - - - - - - - H -7r N 030+"E RELOCATE HYDRANT c=8a GU-845.16 „ �___-_- TN TC-845.63 TC=84684805 . s.9s CONSTRUCTION---- ------- Tc=846.70 L I M I S GU=845. 5 GU=846.42 (Z / \ GU=846.23 1y j V V L- �/ / // -60 (Width Varies) / 84723 846.43 REMOVALS LEGEND: j P� I ZEX. 1' CONTOUR ELEVATION INTERVAL / 7/7 REMOVAL OF PAVEMENT AND ALL BASE MATERIAL, IL INCLUDING BIT., CONC., AND GRAVEL PVMTS. / REMOVAL OF STRUCTURE INCLUDING ALL FOOTINGS AND FOUNDATIONS. REMOVE CURB AND GUTTER. IF IN RIGHT-OF-WAY, COORDINATE WITH LOCAL GOVERNING UNIT. TREE PROTECTION �i#�.# xTREE REMOVAL - INCLUDING ROOTS AND STUMPS 0 � A, 0 Know what's beIow. 1" = 20'-0" Call before you dig. 10'-0" 0 20'-0" 11/25/2019 8:41:02 AM (C Onov H �0�el (rT1 m O M p Civil Engineering ^ Surveying ^ Landscape Architecture 4931 W. 35th Street, Suite 200 St. Louis Park, MN 55416 civilsitegroup.com 612-615-0060 LU C rn M UU� L�0/ ` Y J V J w H2i V Wo O � wZ) 0 l__ 0 JLU Q< Q `L U = o N OM U� JQw aQ N w 06 J a OoFIIIIIIIIIIIIIIII�ZJ �Ly 0 W 0 _ I F z w o J J 0- � Q ,It -) L0 0L0 U w O I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONAL ENGINEER UNDER THE LAWS OF THE STATE OF MINNESO�TA. David J. Knaeble DATE 11/25/19 LICENSE NO. 48776 ISSUE/SUBMITTAL SUMMARY DRAWN BY:BN REVIEWED BY: DK PROJECT NUMBER: 15016.02 REVISION SUMMARY DATE DESCRIPTION REMOVALS PLAN C1 0 ■ COPYRIGHT CIVIL SITE GROUP INC. I I I \ I MATCH EXISTING --_PAVEMENT, TYP. I I 0 i 0 rn MATCH EXISTING C&G, TYP. ,I GU=845.16 TC=845.63 CON C L STRUCTION LIMITS I\L Ill11 VIIVV VVfnLL VV1 `tL RAILING ALONG TOP, SEE ARCH PLANS & SEE GRADING PLAN FOR ELEV. RAILING TO BE MIN. OF S FROM BACK OF -I- `' PUBLIC SIDEWALK. (Width Varies) JJ J \ Q �, � - cP 'p P�PN ° s12o CONC. STAI srN ST SEE ARCH. PLANS El MATCH EXISTING CONC. WALK TYP. 00 _ RETAINING WALL W14241 RAILING ALONG TOP, SEE ARCH PLANS & SEE GRADING �05 PLAN FOR ELEV. RAILING TO BE MIN. OF 3' FROM BACK OF PUBLIC SIDEWALK. / 1R" PikI / /MATCH EXISTING 80 ° ¢&G, TYP. CONCRETE PAD FOR EITHER FUTURE BIKE SHARE STATION OR (5) GROUND MOUNTED "HOOP" STYLE BIKE RACKS o BIKE REPAIR STATION AND PUMP, COORD. W/OWNER " ,fOR SELECTION (8) 24"X24" NOM. NATURAL STONE PILLARS TO MATCr SEATWALL BOULDERS MATCH AT EXIST. WALK, TYP. 4' DIA. CONC PAD FOR ART INSTALLATION GROUND MOUNTED ART PIECE. COORDINATE W/ INSTALLATION OF BASE & LIGHTING "POCKET PARK" PLAZA STAMPED & COLORED CONC., ART PIECE SPACE, (4) BENCHES, NATURAL STONE SEAT WALL BLOCKS, DECORATIVE FENCING & STONE PIERS MATCH EXISTING CONC. WALK, TYP. SITE LAYOUT NOTES: 1. CONTRACTOR SHALL VERIFY LOCATIONS AND LAYOUT OF ALL SITE ELEMENTS PRIOR TO BEGINNING CONSTRUCTION, INCLUDING BUT NOT LIMITED TO, LOCATIONS OF EXISTING AND PROPOSED PROPERTY LINES, EASEMENTS, SETBACKS, UTILITIES, BUILDINGS AND PAVEMENTS. CONTRACTOR IS RESPONSIBLE FOR FINAL LOCATIONS OF ALL ELEMENTS FOR THE SITE. ANY REVISIONS REQUIRED AFTER COMMENCEMENT OF CONSTRUCTION, DUE TO LOCATIONAL ADJUSTMENTS SHALL BE CORRECTED AT NO ADDITIONAL COST TO OWNER. ADJUSTMENTS TO THE LAYOUT SHALL BE APPROVED BY THE ENGINEER/LANDSCAPE ARCHITECT PRIOR TO INSTALLATION OF MATERIALS. STAKE LAYOUT FOR APPROVAL. 2. THE CONTRACTOR SHALL OBTAIN ALL NECESSARY PERMITS PRIOR TO CONSTRUCTION, INCLUDING A RIGHT-OF-WAY AND STREET OPENING PERMIT. 3. THE CONTRACTOR SHALL VERIFY RECOMMENDATIONS NOTED IN THE GEO TECHNICAL REPORT PRIOR TO INSTALLATION OF SITE IMPROVEMENT MATERIALS. 4. CONTRACTOR SHALL FIELD VERIFY COORDINATES AND LOCATION DIMENSIONS OF THE BUILDING AND STAKE FOR REVIEW AND APPROVAL BY THE OWNERS REPRESENTATIVE PRIOR TO INSTALLATION OF FOOTING MATERIALS. 5. LOCATIONS OF STRUCTURES, ROADWAY PAVEMENTS, CURBS AND GUTTERS, BOLLARDS, AND WALKS ARE APPROXIMATE AND SHALL BE STAKED IN THE FIELD, PRIOR TO INSTALLATION, FOR REVIEW AND APPROVAL BY THE ENGINEER/LANDSCAPE ARCHITECT. 6. CURB DIMENSIONS SHOWN ARE TO FACE OF CURB. BUILDING DIMENSIONS ARE TO FACE OF CONCRETE FOUNDATION. LOCATION OF BUILDING IS TO BUILDING FOUNDATION AND SHALL BE AS SHOWN ON THE DRAWINGS. 7. THE CONTRACTOR SHALL SUBMIT SHOP DRAWINGS OR SAMPLES AS SPECIFIED FOR REVIEW AND APPROVAL BY THE ENGINEER/LANDSCAPE ARCHITECT PRIOR TO FABRICATION FOR ALL PREFABRICATED SITE IMPROVEMENT MATERIALS SUCH AS, BUT NOT LIMITED TO THE FOLLOWING, FURNISHINGS, PAVEMENTS, WALLS, RAILINGS, BENCHES, FLAGPOLES, LANDING PADS FOR CURB g3 RAMPS, AND LIGHT AND POLES. THE OWNER RESERVES THE RIGHT TO REJECT INSTALLED MATERIALS NOT PREVIOUSLY APPROVED. 8. PEDESTRIAN CURB RAMPS SHALL BE CONSTRUCTED WITH TRUNCATED DOME LANDING AREAS IN ACCORDANCE WITH A.D.A. REQUIREMENTS -SEE DETAIL. 9. CROSSWALK STRIPING SHALL BE 24" WIDE WHITE PAINTED LINE, SPACED 48" ON CENTER PERPENDICULAR TO THE FLOW OF TRAFFIC. WIDTH OF CROSSWALK SHALL BE 5' WIDE. ALL OTHER PAVEMENT MARKINGS SHALL BE WHITE IN COLOR UNLESS OTHERWISE NOTED OR REQUIRED BY ADA OR LOCAL GOVERNING BODIES. 10. SEE SITE PLAN FOR CURB AND GUTTER TYPE. TAPER BETWEEN CURB TYPES -SEE DETAIL. 11. ALL CURB RADII ARE MINIMUM T UNLESS OTHERWISE NOTED. 12. CONTRACTOR SHALL REFER TO FINAL PLAT FOR LOT BOUNDARIES, NUMBERS, AREAS AND DIMENSIONS PRIOR TO SITE IMPROVEMENTS. 13. FIELD VERIFY ALL EXISTING SITE CONDITIONS, DIMENSIONS. 14. PARKING IS TO BE SET PARALLEL OR PERPENDICULAR TO EXISTING BUILDING UNLESS NOTED OTHERWISE. 15. ALL PARKING LOT PAINT STRIPPING TO BE WHITE, 4" WIDE TYP. 16. BITUMINOUS PAVING TO BE "LIGHT DUTY" UNLESS OTHERWISE NOTED. SEE DETAIL SHEETS FOR PAVEMENT SECTIONS. 17. ALL TREES THAT ARE TO REMAIN ARE TO BE PROTECTED FROM DAMAGE WITH A CONSTRUCTION FENCE AT THE DRIP LINE. SEE LANDSCAPE DOCUMENTS. - RETAINING WALL W/ 42" RAILING ALONG TOP, SEE ARCH PLANS & SEE GRADING PLAN FOR ELEV. RAILING TO / BE MIN. OF T FROM BACK OF / PUBLIC SIDEWALK. EXISTING FIBER OPTIC LINE, / FIELD LOCATE DURING CONSTRUCTION AND PROTECT FROM DAMAGE CITY OF RICHFIELD SITE SPECIFIC NOTES: 1. PERMITS ARE REQUIRED FROM RICHFIELD ENGINEERING DEPARTMENT FOR ANY EXCAVATION IN LYNDALE AVENUE RIGHT-OF-WAY. 2. RICHFIELD ENGINEERING MUST BE PRESENT TO INSPECT ALL CONCRETE FORMS WITHIN RIGHT-OF-WAY PRIOR TO CONCRETE POUR. MINIMUM 24 HOUR NOTICE REQUIRED. SITE AREA TABLE: SITE AREA CALCULATIONS EXISTING CONDITION PROPOSED CONDITION BUILDING COVERAGE ALL PAVEMENTS ALL NON -PAVEMENTS 0 SF 16,246 SF 2,355 SF 0.0% 87.3% 12.7% 3,442 SF 10,054 SF 5,105 SF 18.5% 54.1% 27.4% TOTAL SITE AREA 18,601 SF 100.0% 18,601 SF 100.0% IMPERVIOUS SURFACE EXISTING CONDITION 16,246 SF 87.3% PROPOSED CONDITION 13,496 SF 72.6% DIFFERENCE (EX. VS PROP.) -2,750 SF -14.8% SITE PLAN LEGEND: m m LIGHT DUTY BITUMINOUS PAVEMENT. SEE GEOTECHNICAL REPORT FOR AGGREGATE BASE & WEAR COURSE DEPTH, SEE DEATIL. CONCRETE PAVEMENT AS SPECIFIED (PAD OR WALK) SEE GEOTECHNICAL REPORT FOR AGGREGATE BASE & CONCRETE DEPTHS, SEE DETAIL. PROPERTY LINE CONSTRUCTION LIMITS CURB AND GUTTER -SEE NOTES (T.O.) TIP OUT GUTTER WHERE APPLICABLE -SEE PLAN tt* TRAFFIC DIRECTIONAL ARROW PAVEMENT MARKINGS SIGN AND POST ASSEMBLY. SHOP DRAWINGS REQUIRED l HC = ACCESSIBLE SIGN NP = NO PARKING FIRE LANE ST = STOP CP = COMPACT CAR PARKING ONLY 0 q 0 0 Know what's b@IOW. Call before you dig. A(! L 1 " = 21 10'-0" 0 20'-1 11/25/2019 8:41:06 AM (C 0�Oly H Ro�e (75]aomr Civil Engineering ^ Surveying ^ Landscape Architecture 4931 W. 35th Street, Suite 200 St. Louis Park, MN 55416 civilsitegroup.com 612-615-0060 N Uti Z IIIIIIImm LO z C6 z O 0 LIJ 0 LO Jw Q� 0 `L = U o C:) _U O M LU O (1) U) Z) U) W D � N W 06 < OZ za Q W 0 V0 H w M z LL] J 0 z 1�i�1 J ^ LL 1 O Li u7 O) w co I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONAL ENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA. �:j ) k"Wg-�- David J. Knaeble DATE 1 1 /25/19 LICENSE NO. 48776 ISSUE/SUBMITTAL SUMMARY DRAWN BY:BN REVIEWED BY: DK PROJECT NUMBER: 15016.02 REVISION SUMMARY DATE DESCRIPTION SITE PLAN C200 COPYRIGHT CIVIL SITE GROUP IN I I I I FA nJs � 42.46 43.00\ �v1E 43.14- 0001, 43.19� 44.06 43.37 3' CURB 44.06 T 42.64 / E / 45.90 44.90 '�• ' 401-1 , I1,� " 45.12-\ 44.70 44.46 - P` 45.30 45.36 \9 6FFE= 845.30 43.53 24 43� ° \\ HP 43�53 I ^ / 16" PIN if CONSTRUCTION LIM 43.88 ME / as N 45.90 T' 44.90 ' 45.6 TW /I as 4 39 G/TC \ aa5a 4 , \ ; • A �GU=844.96 O x i 45.30 45.3d TC=845.41 DOOR 45.30 � Ts45.37 i I DOOR . if 22 GU=844.91 46.19 I DOOR / 44.7 44.62 45.2bb // 45.19 5�6 ME i HP DOOR /��. xaI T 44.61 o E 45.66 TC 47.56 TW 47.3 1 / 45.16 G 44.24 44.71 B W 45' °, =- '- 44.8 rn 7 d LP l 30 45., 5 47.54' TbV 44.46 �5��` 45.07 BW S6o 06 Ir � ° ' � 47.57 TW 9 `3S'Q /,I I 844 43.88 47g 45.18 B j' �/o L 45. 3 0�0 43.20 7.4 45. / / � CF V 46 _ _ - -A ~ • 4� ��� C9 61.3' �„ ChoN I SG =84611 28 $T 1 Rim- .00 47. ;' IJ MEN 0. 4^7.41 �8�6�� /- I ° E / t0. 847.16 /BW ---- _�-- ------ ---- 4 47.47 TNL 4 04 a46.71 846.95 �� aQ4 BW i� 9� 4"E 845.96c846.30 ME H �° -�.9 N8 3Q 87.41 -N °30' "E - - 5I 60 $�65� // 4 4� �1`3� GU=845.16 GU- TC= r - TC>846.93 ° , i G01� TC=845.63 84 846 / CON RUC TC=846.70 �\ / LIMI S 00=845. s 1 e ♦/ \/ / / / / I / 1 L- L- I V V L- / (Width Varies) / _--------__ - 847.23 846.43 i \ 44.99 / ME 45:11 b ME o� 45.27 / N 45.45 ME �r. SMH, 5 imt-04 E / 7 � � J 46.19 ';I - 46. 06) ME c -46.12 16.21 ° 46.22- , M E � J 4 9 BW c` 5 �\ TW \ 1 BW \ I GENERAL GRADING NOTES: (C �Oly Ho�0�e 1. SEE SITE PLAN FOR HORIZONTAL LAYOUT & GENERAL GRADING NOTES. (7F] Q (o M r 2. THE CONTRACTOR SHALL COMPLETE THE SITE GRADING CONSTRUCTION (INCLUDING BUT NOT LIMITED TO SITE PREPARATION, SOIL Civil Engineering °Surveying °Landscape Architecture CORRECTION, EXCAVATION, EMBANKMENT, ETC. IN ACCORDANCE WITH THE REQUIREMENTS OF THE OWNER'S SOILS ENGINEER. ALL SOIL ) 4931 W. Street, Suite 200 St. Louis Park, MN 55416 TESTING SHALL BE COMPLETED BY THE OWNER'S SOILS ENGINEER. THE CONTRACTOR SHALL BE RESPONSIBLE FOR COORDINATING ALL civilsitegroup.com 612-615-0060 REQUIRED SOIL TESTS AND INSPECTIONS WITH THE SOILS ENGINEER. 3. GRADING AND EXCAVATION ACTIVITIES SHALL BE PERFORMED IN ACCORDANCE WITH THE NATIONAL POLLUTION DISCHARGE ELIMINATION SYSTEM (NPDES) PERMIT REQUIREMENTS & PERMIT REQUIREMENTS OF THE CITY. 4. PROPOSED SPOT GRADES ARE FLOW -LINE FINISHED GRADE ELEVATIONS, UNLESS OTHERWISE NOTED. 5. GRADES OF WALKS SHALL BE INSTALLED WITH 5% MAX. LONGITUDINAL SLOPE AND 1% MIN. AND 2% MAX. CROSS SLOPE, UNLESS OTHERWISE NOTED. 6. PROPOSED SLOPES SHALL NOT EXCEED 3:1 UNLESS INDICATED OTHERWISE ON THE DRAWINGS. MAXIMUM SLOPES IN MAINTAINED AREAS IS 4:1 7. PROPOSED RETAINING WALLS, FREESTANDING WALLS, OR COMBINATION OF WALL TYPES GREATER THAN 4' IN HEIGHT SHALL BE DESIGNED AND ENGINEERED BY A REGISTERED RETAINING WALL ENGINEER. DESIGN DRAWINGS SHALL BE SUBMITTED FOR REVIEW AND APPROVAL PRIOR TO CONSTRUCTION. 8. THE CONTRACTOR SHALL BE RESPONSIBLE FOR MAINTENANCE OF GRADE STAKES THROUGHOUT THE DURATION OF CONSTRUCTION TO ESTABLISH PROPER GRADES. THE CONTRACTOR SHALL ALSO BE RESPONSIBLE FOR A FINAL FIELD CHECK OF FINISHED GRADES ACCEPTABLE TO THE ENGINEER/LANDSCAPE ARCHITECT PRIOR TO TOPSOIL AND SODDING ACTIVITIES. 9. IF EXCESS OR SHORTAGE OF SOIL MATERIAL EXISTS, THE CONTRACTOR SHALL TRANSPORT ALL EXCESS SOIL MATERIAL OFF THE SITE TO AN AREA SELECTED BY THE CONTRACTOR, OR IMPORT SUITABLE MATERIAL TO THE SITE. 10. EXCAVATE TOPSOIL FROM AREAS TO BE FURTHER EXCAVATED OR REGRADED AND STOCKPILE IN AREAS DESIGNATED ON THE SITE. THE W CONTRACTOR SHALL SALVAGE ENOUGH TOPSOIL FOR RESPREADING ON THE SITE AS SPECIFIED. EXCESS TOPSOIL SHALL BE PLACED IN EMBANKMENT AREAS, OUTSIDE OF BUILDING PADS, ROADWAYS AND PARKING AREAS. THE CONTRACTOR SHALL SUBCUT CUT AREAS, WHERE Cn M 1 TURF IS TO BE ESTABLISHED, TO A DEPTH OF 6 INCHES. RESPREAD TOPSOIL IN AREAS WHERE TURF IS TO BE ESTABLISHED TO A MINIMUM C4 Z DEPTH OF 6 INCHES. LO _ LO 11. FINISHED GRADING SHALL BE COMPLETED. THE CONTRACTOR SHALL UNIFORMLY GRADE AREAS WITHIN LIMITS OF GRADING, INCLUDING x z Z ADJACENT TRANSITION AREAS. PROVIDE A SMOOTH FINISHED SURFACE WITHIN SPECIFIED TOLERANCES, WITH UNIFORM LEVELS OR SLOPES BETWEEN POINTS WHERE ELEVATIONS ARE SHOWN, OR BETWEEN SUCH AND EXISTING GRADES. AREAS THAT HAVE BEEN FINISH O w O POINTS p 0 GRADED SHALL BE PROTECTED FROM SUBSEQUENT CONSTRUCTION OPERATIONS, TRAFFIC AND EROSION. REPAIR ALL AREAS THAT HAVE Lu BECOME RUTTED BY TRAFFIC OR ERODED BY WATER OR HAS SETTLED BELOW THE CORRECT GRADE. ALL AREAS DISTURBED BY THE LL CONTRACTOR'S OPERATIONS SHALL BE RESTORED TO EQUAL OR BETTER THAN ORIGINAL CONDITION OR TO THE REQUIREMENTS OF THE 2 U o NEW WORK. N U O co w 12. PRIOR TO PLACEMENT OF THE AGGREGATE BASE, A TEST ROLL WILL BE REQUIRED ON THE STREET AND/OR PARKING AREA SUBGRADE. THE U) LU CONTRACTOR SHALL PROVIDE A LOADED TANDEM AXLE TRUCK WITH A GROSS WEIGHT OF 25 TONS. THE TEST ROLLING SHALL BE AT THE LU O W Q DIRECTION OF THE SOILS ENGINEER AND SHALL BE COMPLETED IN AREAS AS DIRECTED BY THE SOILS ENGINEER. THE SOILS ENGINEER Q SHALL DETERMINE WHICH SECTIONS OF THE STREET OR PARKING AREA ARE UNSTABLE. CORRECTION OF THE SUBGRADE SOILS SHALL BE z ,Amaxx N COMPLETED IN ACCORDANCE WITH THE REQUIREMENTS OF THE SOILS ENGINEER. NO TEST ROLL SHALL OCCUR WITHIN 10' OF ANY LU > J a UNDERGROUND STORM RETENTION/DETENTION SYSTEMS. �ME a z OW Z O 13. TOLERANCES J � w 13.1. THE BUILDING SUBGRADE FINISHED SURFACE ELEVATION SHALL NOT VARY BY MORE THAN 0.30 FOOT ABOVE, OR 0.30 FOOT BELOW, THE 0 w PRESCRIBED ELEVATION AT ANY POINT WHERE MEASUREMENT IS MADE. z >_ J Q Z00 13.2. THE STREET OR PARKING AREA SUBGRADE FINISHED SURFACE ELEVATION SHALL NOT VARY BY MORE THAN 0.05 FOOT ABOVE, OR 0.10 1 0- FOOT BELOW, THE PRESCRIBED ELEVATION OF ANY POINT WHERE MEASUREMENT IS MADE. C 13.3. AREAS WHICH ARE TO RECEIVE TOPSOIL SHALL BE GRADED TO WITHIN 0.30 FOOT ABOVE OR BELOW THE REQUIRED ELEVATION, UNLESS w LO DIRECTED OTHERWISE BY THE ENGINEER. 13.4. TOPSOIL SHALL BE GRADED TO PLUS OR MINUS 1/2 INCH OF THE SPECIFIED THICKNESS. 14. MAINTENANCE ~ U 14.1. THE CONTRACTOR SHALL PROTECT NEWLY GRADED AREAS FROM TRAFFIC AND EROSION, AND KEEP AREA FREE OF TRASH AND DEBRIS. w 0 14.2. CONTRACTOR SHALL REPAIR AND REESTABLISH GRADES IN SETTLED, ERODED AND RUTTED AREAS TO SPECIFIED TOLERANCES. a DURING THE CONSTRUCTION, IF REQUIRED, AND DURING THE WARRANTY PERIOD, ERODED AREAS WHERE TURF IS TO BE ESTABLISHED I HEREBY CERTIFY THAT THIS PLAN, SHALL BE RESEEDED AND MULCHED. SPECIFICATION, OR REPORT WAS 14.3. WHERE COMPLETED COMPACTED AREAS ARE DISTURBED BY SUBSEQUENT CONSTRUCTION OPERATIONS OR ADVERSE WEATHER, PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY CONTRACTOR SHALL SCARIFY, SURFACE, RESHAPE, AND COMPACT TO REQUIRED DENSITY PRIOR TO FURTHER CONSTRUCTION. LICENSED PROFESSIONAL ENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA. CITY OF RICHFIELD GRADING NOTES: ""� ) kllwi David J. Knaeble 1. RESERVED FOR CITY SPECIFIC GRADING NOTES. DATE 11/25/19 LICENSE No. 48776 ISSUE/SUBMITTAL SUMMARY EROSION CONTROL NOTES: SEE SWPPP ON SHEETS SW1.0-SW1.3 GRADING PLAN LEGEND: EX. V CONTOUR ELEVATION INTERVAL 1137 1.0' CONTOUR ELEVATION INTERVAL 41.26 SPOT GRADE ELEVATION (GUTTER/FLOW LINE UNLESS OTHERWISE NOTED) 891.00 G SPOT GRADE ELEVATION GUTTER DRAWN BY:BN REVIEWED BY: DK 891.00 TC SPOT GRADE ELEVATION TOP OF CURB PROJECT NUMBER: 15016.02 891.00 BS/TS SPOT GRADE ELEVATION BOTTOM OF STAIRS/TOP OF STAIRS REVISION SUMMARY 891.00 ME SPOT GRADE ELEVATION MATCH EXISTING DATE DESCRIPTION GB GRADE BREAK - HIGH POINTS CURB AND GUTTER (T.0 = TIP OUT) EOF=1135.52 EMERGENCY OVERFLOW GRADING PLAN 0 0 Know what's below. 1" = 21 Call before you dig. C 00 �n 101-01, 0 `-M%2`Sn /2019 8:41:11 AM (D COPYRIGHT CIVIL SITE GROUP INC. TRACT I I I I m JJ X$ \ /I JJ T - J FES 21 ° \ IE=843.47 \ I Vie - BQ3 �L\ 83 / rC\ gQ368 3g 7g 0� 1 42 LF 12" SCH40 -_.PVC STORM @ /0 MH 11 L v FIRE DEPAR ENT �� "7- \ 6" COM D DIP CONN CTION, W�SERVICE, OORD. W/MEC 'L B TO WITHIN 5' �� FES 22 FROM BUILDING, - 4 -- --- IE=843.87 _�`COORD. W/MEC 'L ;9 - - 6" SANITARY - - - - - X SERVICE, STUB TO WITHIN S FROM _ O I D NG COORD 6 RIM=845.46 WATE IE=838.66 SERVIC X 0 33 LF 12" SCH40 EX MH PVC STORM @ RIM=846.24 1.00% \ EX. IE (NE)=833± I, EX. IE (W/E)=829.34 PR. IE (NE)=838.33 CORE DRILL -- CONNECTION TO MH sTh Rim , « << «� ---- -- ----- - - - -- _ q - ' - < a 71 846.95 _ 846.30 845.96< � . - � 030' - - - - - H -� N 56.60 ' ----- CBMH 12 -- CONSTRUCT)ON M j =846.70 RIM=844.2 LIMITS IE=839.0�5 PROVIDE INSULATION AT ,,Ij� SALVAGE AND REINSTA�j STORM & WATERMAIN EXISTING HYDRANT WITH CROSSING, SEE DETAIL. ,- NEW GV & VALVE BOX MAKE CONNECTION vvi l r� l TO EXISTING 6" (Width VoHYDRANT LEAD. 8 ; COORD. WITH CITY ^ / 16" PIN / ^ a / I p ° \\ I a ^ ry ^ - CONSTRUCTION LIM ce^ 'L \ \X$k5,, 19 LF 8" SCH40 W/MECH PVC STORM @ STUB IE=835.58 2.009/6 - ROOF DRAINa' CONNECTION. STUB TO 5' FROM BUILDING, COORD ♦ °� 4 �� WITH MECH. r� ♦ ♦ / / IE @ STUB=839 46 I / 'AN MHA y / RIM=845.78 CIE (SW)=834.94 / N IE (E)=834.84 ^" EX SAN. MH RIM=845.04 EX IE (N/S)=834.56 (FIELD VERIFY) PROP IE (W)=834.66 ✓ MAKE CONNECTION PER CITY STANDARDS i 18LF6"SCH40PVC ' �a" ELM ~ SAN @ 1.00% d a° , J d 64 LF 6" SCH40 PVC / SAN @ 1.00% / S69o3 00 01 0' sN _- ,V 847 15 -1 2� o 'IIN -M p2 �� �$p,0'I� / 847.16 846.86 _ d a vo _ GQAN N8903, IY14"E 87.41 \ Go RIM=843.20 �°^ < 0 12 LF 12" SCH40 IE=839.20 18" NYLOPLAST PVC STORM @ / 1.00% WITH 18" DOME GRATE IN GENERAL UTILITY NOTES: 1. SEE SITE PLAN FOR HORIZONTAL DIMENSIONS AND LAYOUT. 2. CONTRACTOR SHALL FIELD VERIFY LOCATION AND ELEVATION OF EXISTING UTILITIES AND TOPOGRAPHIC FEATURES PRIOR TO CONSTRUCTION. THE CONTRACTOR SHALL IMMEDIATELY NOTIFY THE ENGINEER OF DISCREPANCIES OR VARIATIONS FROM THE PLANS. 3. ALL EXISTING UTILITY LOCATIONS SHOWN ARE APPROXIMATE. CONTACT "GOPHER STATE ONE CALL" (651-454-0002 OR 800-252-1166) FOR UTILITY LOCATIONS, 48 HOURS PRIOR TO CONSTRUCTION. THE CONTRACTOR SHALL REPAIR OR REPLACE ANY UTILITIES THAT ARE DAMAGED DURING CONSTRUCTION AT NO COST TO THE OWNER. 4. UTILITY INSTALLATION SHALL CONFORM TO THE CURRENT EDITION OF "STANDARD SPECIFICATIONS FOR WATER MAIN AND SERVICE LINE INSTALLATION" AND "SANITARY SEWER AND STORM SEWER INSTALLATION" AS PREPARED BY THE CITY ENGINEERS ASSOCIATION OF MINNESOTA (CEAM), AND SHALL CONFORM WITH THE REQUIREMENTS OF THE CITY AND THE PROJECT SPECIFICATIONS. 5. CASTINGS SHALL BE SALVAGED FROM STRUCTURE REMOVALS AND RE -USED OR PLACED AT THE DIRECTION OF THE OWNER. 6. ALL WATER PIPE SHALL BE CLASS 52 DUCTILE IRON PIPE (DIP) AWWA C151, ASME 1316.4, AWWA C110, AWWA C153 UNLESS OTHERWISE NOTED. 7. ALL SANITARY SEWER SHALL BE SDR 26 POLYVINYL CHLORIDE (PVC) ASTM D3034 & F679, OR SCH 40 ASTM D1785, 2665, ASTM F794, 1866) UNLESS OTHERWISE NOTED. 8. ALL STORM SEWER PIPE SHALL BE HDPE ASTM F714 & F2306 WITH ASTM D3212 SPEC FITTINGS UNLESS OTHERWISE NOTED. 9. PIPE LENGTHS SHOWN ARE FROM CENTER TO CENTER OF STRUCTURE OR TO END OF FLARED END SECTION. 10. UTILITIES ON THE PLAN ARE SHOWN TO WITHIN 5' OF THE BUILDING FOOTPRINT. THE CONTRACTOR IS ULTIMATELY RESPONSIBLE FOR THE FINAL CONNECTION TO BUILDING LINES. COORDINATE WITH ARCHITECTURAL AND MECHANICAL PLANS. 11. CATCH BASINS AND MANHOLES IN PAVED AREAS SHALL BE SUMPED 0.04 FEET. ALL CATCH BASINS IN GUTTERS SHALL BE SUMPED 0.15 FEET PER DETAILS. RIM ELEVATIONS SHOWN ON THIS PLAN DO NOT REFLECT SUMPED ELEVATIONS. 12. ALL FIRE HYDRANTS SHALL BE LOCATED 5 FEET BEHIND BACK OF CURB UNLESS OTHERWISE NOTED. 13. HYDRANT TYPE, VALVE, AND CONNECTION SHALL BE IN ACCORDANCE WITH CITY REQUIREMENTS. HYDRANT EXTENSIONS ARE INCIDENTAL. 14. A MINIMUM OF 8 FEET OF COVER IS REQUIRED OVER ALL WATERMAIN, UNLESS OTHERWISE NOTED. EXTRA DEPTH MAY BE REQUIRED TO MAINTAIN A MINIMUM OF 18" VERTICAL SEPARATION TO SANITARY OR STORM SEWER LINES. EXTRA DEPTH WATERMAIN IS INCIDENTAL. 15. A MINIMUM OF 18 INCHES OF VERTICAL SEPARATION AND 10 FEET OF HORIZONTAL SEPARATION IS REQUIRED FOR ALL UTILITIES, UNLESS OTHERWISE NOTED. 16. ALL CONNECTIONS TO EXISTING UTILITIES SHALL BE IN ACCORDANCE WITH CITY STANDARDS AND COORDINATED WITH THE CITY PRIOR TO CONSTRUCTION. 17. CONNECTIONS TO EXISTING STRUCTURES SHALL BE CORE -DRILLED. 18. COORDINATE LOCATIONS AND SIZES OF SERVICE CONNECTIONS WITH THE MECHANICAL DRAWINGS. 19. COORDINATE INSTALLATION AND SCHEDULING OF THE INSTALLATION OF UTILITIES WITH ADJACENT CONTRACTORS AND CITY STAFF. 20. ALL STREET REPAIRS AND PATCHING SHALL BE PERFORMED PER THE REQUIREMENTS OF THE CITY. ALL PAVEMENT CONNECTIONS SHALL BE SAWCUT. ALL TRAFFIC CONTROLS SHALL BE PROVIDED BY THE CONTRACTOR AND SHALL BE ESTABLISHED PER THE REQUIREMENTS OF THE MINNESOTA MANUAL ON UNIFORM TRAFFIC CONTROL DEVICES (MMUTCD) AND THE CITY. THIS SHALL INCLUDE BUT NOT BE LIMITED TO SIGNAGE, BARRICADES, FLASHERS, AND FLAGGERS AS NEEDED. ALL PUBLIC STREETS SHALL BE OPEN TO TRAFFIC AT ALL TIMES. NO ROAD CLOSURES SHALL BE PERMITTED WITHOUT APPROVAL BY THE CITY. 21. ALL STRUCTURES, PUBLIC AND PRIVATE, SHALL BE ADJUSTED TO PROPOSED GRADES WHERE REQUIRED. THE REQUIREMENTS OF ALL OWNERS MUST BE COMPLIED WITH. STRUCTURES BEING RESET TO PAVED AREAS MUST MEET OWNERS REQUIREMENTS FOR TRAFFIC LOADING. 22. CONTRACTOR SHALL COORDINATE ALL WORK WITH PRIVATE UTILITY COMPANIES. 23. CONTRACTOR SHALL COORDINATE CONNECTION OF IRRIGATION SERVICE TO UTILITIES. COORDINATE THE INSTALLATION OF IRRIGATION SLEEVES NECESSARY AS TO NOT IMPACT INSTALLATION OF UTILITIES. 24. CONTRACTOR SHALL MAINTAIN AS -BUILT PLANS THROUGHOUT CONSTRUCTION AND SUBMIT THESE PLANS TO ENGINEER UPON COMPLETION OF WORK. 25. ALL JOINTS AND CONNECTIONS IN STORM SEWER SYSTEM SHALL BE GASTIGHT OR WATERTIGHT. APPROVED RESILIENT RUBBER JOINTS MUST BE USED TO MAKE WATERTIGHT CONNECTIONS TO MANHOLES, CATCHBASINS, OR OTHER STRUCTURES. 26. ALL PORTIONS OF THE STORM SEWER SYSTEM LOCATED WITHIN 10 FEET OF THE BUILDING OR WATER SERVICE LINE MUST BE TESTED IN ACCORDANCE WITH MN RULES, CHAPTER 4714, SECTION 1109.0. CITY OF RICHFIELD UTILITY NOTES: 1. RESERVED FOR CITY SPECIFIC UTILITY NOTES. UTILITY LEGEND: CATCH BASIN MANHOLE ►/ GATE VALVE AND VALVE BOX PROPOSED FIRE HYDRANT WATER MAIN I SANITARY SEWER » STORM SEWER O� 0 0 0 Know what's below. Call before you dig. FES D.PR,. A(! 1" = 20'-0" 10'-0" 0 20'-0" 11/25/2019 8:41:16 AM (C 0�Oly H �0�e o7 n Oo M r Civil Engineering ^ Surveying ^ Landscape Architecture 4931 W. 35th Street, Suite 200 St. Louis Park, MN 55416 civilsitegroup.com 612-615-0060 Uj Cl) Q CV Nt T 1.0 i z C.)LL O 0 JLU a U N Q J O LU a Z �Mmm < Z LU LU LU 0 Z J O ,It a u7 O) U LU 3 O ti Z L0 v! Z LLl 0 L0 0 U� O00 M �w H U) U) -v i Oa Z O H LU J z 0- w co I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECT SUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONAL ENGINEER UNDER THE LAWS OF THE STATE OF MINNESOTA. �:j ) k"Wg� David J. Knaeble DATE 1 1 /25/19 LICENSE NO. 48776 ISSUE/SUBMITTAL SUMMARY DRAWN BY:BN REVIEWED BY: DK PROJECT NUMBER: 15016.02 REVISION SUMMARY DATE DESCRIPTION UTILITY PLAN C400 COPYRIGHT CIVIL SITE GROUP INC. _ �M _ d PLANT SCHEDULE -ENTIRE SITE �Oly H g0�e j / SYM QUANT. COMMON NAME BOTANICAL NAME SIZE ROOT COMMENTS (75] Q (K:D V r DECIDUOUS TREES Civil Engineering ^ Surveying ^ Landscape Architecture 4931 W. 35th Street, Suite 200 CONSTRUCTION LIM ABM 2 Autumn Blaze Maple Acer x freemanii 'Jeffersred' 2.5" CAL. B&B STRAIGHT LEADER. FULL FORM St. Louis Park, MN 55416 \ SHL 2 SKYLINE HONEYLOCUST Gleditsia triacanthos'Skycole' 2.5" CAL. B&B STRAIGHT LEADER. FULL FORM civilsitegroup.com 612-615-0060 EKC 1 Espresso Kentucky Coffeetree Gymnocladus dioicus'Espresso' 4 1 / ^ EVERGREEN TREES I J LAD TYP. 51 M� `� BHS 2 BLACK HILLS SPRUCE Picea glauca'Densata' 6' ht. B&B STRAIGHT LEADER. FULL FORM I ERC 2 Eastern Red Juniper Juniperus virginiana -AH 4� 9 TOTAL °_v - SHL 1 BHS - J 2 E /o a ERC ,o �; = ORNAMENTAL TREES I ���� �S % / '1 SSC 2 SPRING SNOW FLOWERING CRAB Malus'Spring Snow' 1.5" CAL. B&B STRAIGHT LEADER. FULL FORM RBC 4 RED BARON FLOWERING CRAB Malus'Red Baron' 1.5" CAL. B&B STRAIGHT LEADER. FULL FORM / 10-BHBS ; > 6 TOTAL / �45.04 � k�p2 / �� SHRUBS - CONIFEROUS & EVERGREEN �.84 ss / �� •'�:.: ;.:....':,`�� � � ._ MGD 9 Muskingum Gray Dogwood Cornus racemosa Muszam 36 HT. CONT. / ' 34 - FIG , .;A ..0 _ `' : DHW 10 Dark Horse Weigela Weigela florida 'Dark Horse' 24" HT. CONT. SGJ 2 Sea Green Juniper Juniperus chinensis'Sea Green' 24" HT. CONT. :...: ;25-6HB c� �1� PA 4 Pyramidal Arborvitae Thuja occidentalis Pyramidalis /� - ABM i °.� SHJ 7 Sky High Juniper Juniperus scopulorum 'Bailigh' - KF - 8 G �. 1 -EKC 3 -CADAH 6 Annabelle Hydrangea Hydrangea arborescens 'Annabelle' LAWN, SEE 4..,CAD.- S 38 TOTAL Uj - - - - - LEGEND, TYP. BS .: 18" MAINT. STRIP, SEE 'l'. SSA.' . 46 - CA c PERENNIALS & GRASSES z c~o DETAIL & LEGEND, TYP. d �� KFG 64 KARL FOERSTER GRASS Calamagrostis x acutiflora "Karl Foerster" #1 CONT. _ _� LO 3 - LSRS / TYP SEE LEGEND, , . BHBS 45 Blue Heaven Little Blue Stem Schizachyrium scoparium'Blue Heaven' ., ,..: :. .. I ,' "� = 18 MAINT. STRIP, SEE z 4 � � ` LSRS 25 Little Spire Russian Sage Perovskia Little Spire' #1 CONT. �. DETAIL &LEGEND, TYP. 4-DHW / BES 42 Goldsturm Rudbeckia Rudbeckia fulgida'Goldsturm' Q w O GU=844.96 2 - MGD ` 11�7 - VMG �w >, CAD 115 Chicago Apache Daylily Hemerocallis 'Chicago Apache' J p TG=8 .41 3 -LSRS 2 - MGD 3 -AJS PPCB 37 PLUM PUDDING CORAL BELLS Heuchera'Plum Pudding' #1 CONT. J w TC=845.37 _ Q Q i n � , GU=844.9 J AJS 3 Autumn Joy Sedum Sedum'Autumn Joy' #1 CONT. 1 -SHL TEPPERS, SEE LEGEND �� 6�h ILL U o k c0 �� VMG 7 Variegated Moor Grass Molinia caerulea 'Variegata' #1 CONT. U O co o y LAWN, SEE 6 DHW , , ��" 0°� 338 TOTAL LU o / LEGEND, TYP. 3 LSRS - �; I Z) ° , R, SEE 1-ss��;� `- ° �./ _ LANDSCAPE NOTES: O w Cn / I LEGEND, TY pSE --- S69�- D � Sp6„ '' g3 �` WHERE SHOWN, SHRUB &PERENNIAL BEDS SHALL BE MULCHED WITH 4 ARCHITECT THROUGHOUT THE DURATION OF THE CONTRACT. LANDSCAPE 10. SWEEP AND MAINTAIN ALL PAVED SURFACES FREE OF DEBRIS GENERATED Z ,�,,,xx Q DEPTH (MINIMUM AFTER INSTALLATION ANDIOR TOP DRESSING MATERIALS PART OF THE CONTRACT SHALL BE WARRANTED FOR ONE (1) FROM LANDSCAPE CONTRACTOR'S ACTIVITIES. a LU W J y� ENS OPERATIONS OF ROCK MULCH - SEE LEGEND BELOW. FULL GROWING SEASONS FROM SUBSTANTIAL COMPLETION DATE. I ��y 16 - L o `V ) 11. REPAIR AT NO COST TO THE OWNER IRRIGATION SYSTEM DAMAGED FROM Q O Z �° s ° sr �` / /ryo 2. ALL TREES SHALL BE MULCHED WITH SHREDDED CYPRESS MULCH TO 6. ALL AREAS DISTURBED BY CONSTRUCTION ACTIVITIES SHALL RECEIVE 4" LANDSCAPE CONSTRUCTION ACTIVITIES. w 0 cnfll _ - - - 50 - ` ° El �_<<« OUTER EDGE OF SAUCER OR TO EDGE OF PLANTING BED F APPLICABLE LAYER TOPSOIL AND SOD AS SPECIFIED UNLESS OTHERWISE NOTED ON ° �< �/ </ I A 12. PROVIDE SITE WIDE IRRIGATION SYSTEM DESIGN AND INSTALLATION. W Q � ALL MULCH SHALL BE KEPT WITHIN A MINIMUM OF 2" FROM TREE TRUNK. THE DRAWINGS. 0 � a- 2k SYSTEM SHALL BE FULLY PROGRAMMABLE AND CAPABLE OF ALTERNATEPPCf7R LLI N�. _� $$ j' 3. PLANT MATERIALS SHALL CONFORM WITH THE AMERICAN ASSOCIATION OF 7. COORDINATE LOCATION OF VEGETATION WITH UNDERGROUND AND DATE WATERING. THE SYSTEM SHALL PROVIDE HEAD TO HEAD OR DRIP >_ J Q svo "sr--r_sea �Gn6 ______ ______________ --�"_ 4 ' a NURSERYMEN STANDARDS AND SHALL BE OF HARDY STOCK, FREE FROM OVERHEAD UTILITIES, LIGHTING FIXTURES, DOORS AND WINDOWS. COVERAGE AND BE CAPABLE OF DELIVERING ONE INCH OF PRECIPITATION _J 0- IY Lo �- H a °° N89030'24"E 87.41 D THE PUBLIC RIGHT-OF-WAY TO O _ DISEASE DAMAGE AND DISFIGURATION CONTRACTOR IS RESPONSIBLE CONTRACTOR SHALL STAKE IN THE FIELD FINAL LOCATION OF TREES AN PER WEEK SYSTEM SHALL EXTEND INTO � � - , - - - - - - �'I FOR MAINTAINING PLUMPNESS OF PLANT MATERIAL FOR DURATION OF SHRUBS FOR REVIEW AND APPROVAL BY THE LANDSCAPE ARCHITECT THE EDGE OF PAVEMENT/BACK OF CURB. - - - - - TG_8 3 N °30 1y E 56.60 4.\ , 3 `b- - ) /� u7 Gu=saa.16 G°=g46505 ACCEPTANCE PERIOD. PRIOR TO INSTALLATION. \` LO TC=s45.63 cu_8 rC=s46. c=s4693 ��D 13. CONTRACTOR SHALL SECURE APPROVAL OF PROPOSED IRRIGATION UJI COWRUC Tc=s4s.7o 4. UPON DISCOVERY OF A DISCREPANCY BETWEEN THE QUANTITY OF 8. ALL PLANT MATERIALS SHALL BE WATERED AND MAINTAINED UNTIL SYSTEM INCLUDING PRICING FROM OWNER, PRIOR TO INSTALLATION. Gu=s4s.z3 LIMITS GU=845. 5 Gu=a46.42 DO`PLANTS SHOWN ON THE SCHEDULE AND THE QUANTITY SHOWN ON THE ACCEPTANCE. 14. SEE IRRIGATION NOTES FOR GENERAL &SPECIFIC IRRIGATION -- �°��•,� PLAN, THE PLAN SHALL GOVERN. � p/ 4 9. REPAIR AT NO COST TO OWNER ALL DAMAGE RESULTING FROM SPECIFICATIONS - COMPLETE SHOP DRAWINGS REQUIRED PRIOR TO U I� 5. CONDITION OF VEGETATION SHALL BE MONITORED BY THE LANDSCAPE LANDSCAPE CONTRACTOR'S ACTIVITIES. INSTALLATION 3 /I/ F- l , . L_ , 4 IRRIGATION NOTES: (Width Varies) / LEGEND I HEREBY CERTIFY THAT THIS PLAN, FACE OF BUILDING, WALL, OR STRUCTURE 18" - VERIFY W/ PLAN SLOPE - MIN. 2%, MAX.5:1 MIN. 3" LAYER OF ROCK MULCH AS SPECIFIED. PROVIDE SAMPLE TO VERIFY W/ GRADING PLAN LANDSCAPE ARCHITECT FOR APPROVAL PRIOR TO INSTALLATION FINISHED GRADE STAKED LANDSCAPE EDGER AS SPECIFIED, SEE MANUFACTURER'S INSTRUCTIONS AND SPECS. FOR INSTALLATION AND PLACEMENT WATER PERMEABLE GEOTEXTILE FABRIC AS SPECIFIED III -III -I I COMPACTED SUBGRADE AGGREGATE MAINTANENCE STRIP NTS PRUNE AS FIELD DIRECTED BY THE LANDSCAPE ARCHITECT TO IMPROVE APPEARANCE (RETAIN NORMAL TREE SHAPE) THREE 2"X4"X8' WOODEN STAKES, STAINED BROWN WITH TWO STRANDS OF WIRE TWISTED TOGETHER. STAKES SHALL BE PLACED AT 120' TO ONE ANOTHER. WIRE SHALL BE THREADED THROUGH NYLON STRAPPING WITH GROMMETS. ALTERNATE STABILIZING METHODS MAY BE PROPOSED BY CONTRACTOR. TRUNK FLARE JUNCTION: PLANT TREE V-2" ABOVE EXISTING GRADE COMPACT BOTTOM OF PIT, TYP. CUT AND REMOVE BURLAP FROM TOP 1/3 OF ROOT BALL. IF NON -BIODEGRADABLE, REMOVE COMPLETELY BACKFILL AS SPECIFIED MULCH TO OUTER EDGE OF SAUCER OR TO EDGE OF PLANTING BED, IF APPLICABLE. ROCK OR ORGANIC MULCH, SEE GENERAL LANDSCAPE NOTES AND PLAN NOTES FOR MULCH TYPE. KEEP MULCH MIN. 2" FROM PLANT TRUNK EXISTING GRADE SLOPE SIDES OF HOLE OR VERTICAL SIDES AT EDGE OF PLANTING BED RULE OF THUMB - MODIFY EXCAVATION BASED ON LOCATION OF PLANT MATERIAL AND DESIGN OF BEDS THREE TIMES WIDTH OR OVERALL PLANT PLACEMENT OF ROOTBALL DECIDUOUS & CONIFEROUS TREE PLANTING NTS 1. ENTIRE SITE SHALL BE FULLY IRRIGATED. THE CONTRACTOR SHALL SUBMIT 15. GROUP VALVE BOXES TOGETHER FOR EASE WHEN SERVICE IS REQUIRED. ALL TREE RINGS -SHREDDED CYPRESS MULCH, SAMPLES REQUIRED SPECIFICATION, OR REPORT WAS IRRIGATION SHOP DRAWINGS FOR REVIEW AND APPROVAL BY THE LOCATE IN PLANT BED AREAS WHENEVER POSSIBLE. PREPARED BY ME OR UNDER MY DIRECT LANDSCAPE ARCHITECT PRIOR TO INSTALLATION. SUPERVISION AND THAT I AM A DULY PRUNE AS FIELD DIRECTED BY THE LANDSCAPE 16. IRRIGATION CONTROLLER LOCATION SHALL BE VERIFIED ON -SITE WITH ALL PLANTING BEDS -DECORATIVE ROCK MULCH, 1"-3" CRUSHED "TRAP" LICENSED LANDSCAPE ARCHITECT UNDER a ( ARCHITECT TO IMPROVE APPEARANCE (RETAIN NORMAL SHAPE FOR SPECIES) 2. SEE MECHANICAL AND ELECTRICAL PLANS AND SPECIFICATIONS FOR OWNER'S REPRESENTATIVE. ROCK, DK. GREY IN COLOR, SAMPLES REQUIRED. PROVIDE EDGING AS THE LAWS OF THE STATE of MINNESOTA. t IRRIGATION WATER, METER, AND POWER CONNECTIONS. SHOWN O I PLAN PLANT TOP OF ROOTBALL 1 2" ABOVE ABOVE 17. CONTROL WIRES: 14 GAUGE DIRECT BURIAL, SOLID COPPER IRRIGATION SURROUNDING GRADE 3. CONTRACTOR TO VERIFY LOCATION OF ALL UNDERGROUND/ABOVE GROUND WIRE. RUN UNDER MAIN LINE. USE MOISTURE -PROOF SPLICES AND SPLICE LAWN -LOCALLY GROWN/SOURCED BLUE GRASS -BASED SOD, CUT WITHIN c, ROCK OR ORGANIC MULCH, SEE GENERAL LANDSCAPE FACILITIES PRIOR TO ANY EXCAVATION/INSTALLATION. ANY DAMAGE TO ONLY AT VALVES OR PULL BOXES. RUN SEPARATE HOT AND COMMON WIRE ; 24 HRS. OF INSTALLATION. "BIG ROLL" INSTALLATION PREFERRED WHERE AVAILABLE =-- � NOTES AND PLAN NOTES FOR MULCH TYPE. KEEP UNDERGROUND/ABOVE GROUND FACILITIES SHALL BE THE RESPONSIBILITY TO EACH VALVE AND ONE (1) SPARE WIRE AND GROUND TO FURTHEST Patrick J. Sarver w�- MULCH MIN. 2" FROM PLANT TRUNK OF THE CONTRACTOR AND COSTS ASSOCIATED WITH CORRECTING VALVE FROM CONTROLLER. LABEL OR COLOR CODE ALL WIRES. ROCK MAINT. STRIP AT BLDG FOUNDATION - 1" DIA. CRUSHED "TRAP" ROCK, DATE 11/25/19 LICENSE No. 24904 ROOTS AT OUTER EDGE OF ROOTBALL LOOSENED TO DAMAGES SHALL BE BORNE ENTIRELY BY THE CONTRACTOR. DK. GREY IN COLOR, OVER FILTER FABRIC, SAMPLES REQUIRED. PROVIDE ENSURE PROPER BACKFILL-TO-ROOT CONTACT 18. AVOID OVER SPRAY ON BUILDINGS, PAVEMENT, WALLS AND ROADWAYS BY EDGING AS SHOWN ON PLAN ISSUE/SUBMITTAL SUMMARY EXISTING GRADE 4. SERVICE EQUIPMENT AND INSTALLATION SHALL BE PER LOCAL UTILITY INDIVIDUALLY ADJUSTING RADIUS OR ARC ON SPRINKLER HEADS AND FLOW DATE DESCRIPTION I -III- SLOPE SIDES OF HOLE OR VERTICAL SIDES AT EDGE OF COMPANY STANDARDS AND SHALL BE PER NATIONAL AND LOCAL CODES. CONTROL ON AUTOMATIC VALVE. 11/06/19 CITY SUBMITTAL PLANTING BED EXACT LOCATION OF SERVICE EQUIPMENT SHALL BE COORDINATED WITH 11/25/19 RESUBMITTAL III III III BACKFILL AS PER SPECIFICATION THE LANDSCAPE ARCHITECT OR EQUIVALENT AT THE JOB SITE. 19. ADJUST PRESSURE REGULATING VALVES FOR OPTIMUM PRESSURE ON SITE. PROPOSED CANOPY TREE SYMBOLS CITY I DO NOT EXCAVATE BELOW ROOTBALL. 20. USE SCREENS ON ALL HEADS. -SEE PLANT SCHEDULE AND PLAN -III -III -III -III -III -III RULE OF THUMB - MODIFY EXCAVATION BASED ON LOCATION OF PLANT MATERIAL AND DESIGN OF BEDS 5. CONTRACTOR SHALL COORDINATE WITH LOCAL UTILITY COMPANY FOR THE PROPOSED ELECTRICAL SERVICE AND METERING FACILITIES. 21. A SET OF AS -BUILT DRAWINGS SHALL BE MAINTAINED ON -SITE AT ALL TIMES _ k/ FOR SPECIES AND PLANTING SIZES THREE TIMES WIDTH OF ROOTBALL OR OVERALL PLANT PLACEMENT IN AN UPDATED CONDITION 6. IRRIGATION WATER LINE CONNECTION SIZE IS 1%AT BUILDING. VERIFY ." DECIDUOUS & CONIFEROUS SHRUB PLANTING WITH MECHANICAL PLANS.COVAGE. 22. ALL PIPE 3" AND OVER SHALL HAVE THRUST BLOCKING AT EACH TURN. NTS 7. ALL MAIN LINES SHALL BE 18" BELOW FINISHED GRADE. 23. ALL AUTOMATIC REMOTE CONTROL VALVES WILL HAVE 3" MINIMUM DEPTH �a o PROPOSED EVERGREEN TREE SYMBOLS -SEE PLANT SCHEDULE AND PLAN FOR SPECIES AND PLANTING SIZES 8. ALL LATERAL LINES SHALL BE 12" BELLOW FINISHED GRADE. OF 3/4" WASHED GRAVEL UNDERNEATH VALVE AND VALVE BOX. GRAVEL SHALL EXTENT 3" BEYOND PERIMETER OF VALVE BOX. 9. ALL EXPOSED PVC RISERS, IF ANY, SHALL BE GRAY IN COLOR. 24. THERE SHALL BE 3" MINIMUM SPACE BETWEEN BOTTOM OF VALVE BOX PROPOSED ORNAMENTAL TREE SYMBOLS - SEE PLANT PLANT TOP OF ROOTBALL 1-2" ABOVE ABOVE 10. CONTRACTOR SHALL LAY ALL SLEEVES AND CONDUIT AT 2'-0" BELOW THE COVER AND TOP OF VALVE STRUCTURE. SCHEDULE AND PLAN FOR SPECIES AND PLANTING SIZES d SURROUNDING GRADE FINISHED GRADE OF THE TOP OF PAVEMENT. EXTEND SLEEVES TO Z-0" ° d ROCK OR ORGANIC MULCH, SEE GENERAL LANDSCAPE BEYOND PAVEMENT. NOTES AND PLAN NOTES FOR MULCH TYPE. KEEP PROPOSED DECIDUOUS AND EVERGREEN SHRUB SYMBOLS - SEE MULCH MIN. 2" FROM PLANT STEM 11. CONTRACTOR SHALL MARK THE LOCATION OF ALL SLEEVES AND CONDUIT PLANT SCHEDULE AND PLAN FOR SPECIES AND PLANTING SIZES a ROOTS AT OUTER EDGE OF ROOTBALL LOOSENED TO WITH THE SLEEVING MATERIAL "ELLED" TO Z-0" ABOVE FINISHED GRADE AND PROPOSED PERENNIAL PLANT SYMBOLS - SEE PLANT DRAWN BY:BN REVIEWED BY: DK ENSURE PROPER BACKFILL-TO-ROOT CONTACT CAPPED. SCHEDULE AND PLAN FOR SPECIES AND PLANTING SIZES PROJECT NUMBER: 15016.02 . EXISTING GRADE 12. FABRICATE ALL PIPE TO MANUFACTURE'S SPECIFICATIONS WITH CLEAN AND REQUIRED RED LANDSCAPE CALCULATIONS: EDGING -COMMERCIAL GRADE STEEL, INCLUDE ALL ENDS, CORNERS & REVISION SUMMARY - .:;�' .:-III -:.. .. ''' I- SLOPE SIDES OF HOLE OR VERTICAL SIDES AT EDGE OF SQUARE CUT JOINTS. USE QUALITY GRADE PRIMER AND SOLVENT CEMENT STAKES PER MANUF. INSTALL PER MANUF. INSTRUCTIONS/SPECS. PROVIDE PLANTING BED FORMULATED FOR INTENDED TYPE OF CONNECTION. BACKFILL AS PER SPECIFICATION DO NOT EXCAVATE BELOW ROOTBALL. 13. BACKFILL ALL TRENCHES WITH SOIL FREE OF SHARP OBJECTS AND DEBRIS. MODIFY EXCAVATION BASED ON LOCATION OF PLANT SIZE VARIES- MATERIAL AND DESIGN OF BEDS OR OVERALL PLANT 14. ALL VALVE BOXES AND COVERS SHALL BE BLACK IN COLOR. SEE LANDSCAPE PLAN PLACEMENT PRODUCT DATA & SHOP DRAWING PRIOR TO INSTALL DATE DESCRIPTION STEPPERS - NATURAL STONE, 20"X20" CUT FINISH PREFERRED, PROVIDE SURFACE FINISH OPTIONS & PRODUCT,DATA PERENNIAL BED PLANTING NTS * Site required less than 10trees,therefore "Minimum I ANI�SC:APF PI AN Ove rstory Tree Size" requirments, as shown in zoningord., are not required to be met. Min. sizes: Overstory/Evergreen trees=2.5" cal. Ornamental trees=1.5" cal. Shrubs= 5gal. �0 o Know what's below. Callbefore you dig. A(! 1 " = 20'-0" 10'-0" 0 20'-0" 11 /25/2019 8:41:36 AM Ll ■ 0 COPYRIGHT CIVIL SITE GROUP INC. FILTER FABRIC, TYP O O O RUH01�QBM 00 �O ' BOULDER WALL, TYP. O ux p 95% COMPACTED BACKFILL SOIL IN 6" LIFTS Civil Engineering " Surveying - Landscape Architecture 4931 W. 35th Street, Suite 200 St. Louis Park, MN 55416 LAWN, SEE LEGEND, TYP. / 5 - MGD / /' I=1 I=1111 11=1 III—III—III-1 111—I 1-I 1-I I -III a / � FINISH GRADE, TYP. civilsitegroup.com 612 -615-0060 . 12 - PPCB a I C I —I � 1—I � 1—I � I —I � NATURAL STONE / I I —I I-1 I-1 I-1 _ I-1 1=1 1=1 1=1 1=� / LANDSCAP 2 SGJ I I —I 1—I I 1—I I I —I 11— — — —_—_ 6" MINIMUM COMPACTED WALL, SEE GRADING & / 1=1 1=1 1=1 1=1 III=III=III=III=III—= AGGREGATE LEVELING PAD LANDSCAPE PLANS -BHS - .• .. : ' � , , _ =III=111=1I1=1I1= COMPACTED SUBGRADE 6-AH BOULDER WALL ��� 1 ♦ ♦ N T S A - 2 ♦ CONCRET-E PAD FP ER FUTURE ♦ BIKE SHARE STATION (5) GROUND MOUNTED "Ho " S BIKE RACKS ♦ / / / �I fl / 2" CLEAR ��' 1 BRICK VENEER WITH 3/8" MORTAR- COLOR TO MATCH BUILDING O ° i — (TYP.) // ° CONDUIT REQUIRED FOR FREE STANDING PIERS 1-BES u I I L _ #3 MASONRY TIES @12" O.C. VERTICALLY ALL SIDES 1 - BHS 7 SHJ 4 / / ^ / 11 /-- (2) HOLES FOR STEEL DOWELS INTO CAP #4 TIES @12" HORIZONTAL AND 4-#5 VERTICALLY o ` / 1 LJ ------I--- (TYP.) POURED CONCRETE INFILL I I LU 1 -ERC �,, BIKE REPAIR STATION AND PUMP, COORD /OWNER / ^ / ^ , SECTION C-C' () / ST. STEELNDOWELSNINLONG CONCRETE INFILL AND CAP PLAN (� CV ti ,�� FOR SEL,CTI / GRANITE M Z LC) 10 � o N ^ MORTAR DOWEL TO GRANITE (2) DOWN LIGHTS PER COLUMN. SMOOTH FINISH PRECAST CONC. CAP 1'-11" THEOS 103ANTH LO >- r/'�., to / / ANTHRACITE. AOCITOE. G v, z \� �� / ^ 1/4" SAW CUT GROOVES IN BOTTOM OF BY SLV LIGHTING NORTH AMERICA CONCRETE CAP ALL FOUR SIDES 0 O w O Q o _ / \7 �^ / ^ _ TYP' e • J. -° - • '� o ° ::l NATURAL STONE VENEER AROUND CONC. INFILL WITH NO EXPOSED MORTAR FOR DRY STACK APPEARANCE LLJ L.L = Q O : - _ ^ (8) 24"X24" NOM. NAT L / �' • • . ° __ PROVIDE (2) ELECTRICAL BOXES AND `�, CONDUIT. RUN TO SWITCHING INDOORS SEE ELECTRICAL. N _� O o co LU � ) v J - - - 7- E ILLARS TO 4 TC i ^ VAMLL ° , . POURED CONCRETE INFILL LU 0 Q BOULDERS ° • C . C' #4 TIES @12" HORIZONTAL AND 4-#5 VERTICALLY (TYP.) a W p�S N -v J O - — - \ 3-CAD / SMH Rim=845.04 , • , °• #3 MASONRY TIES @12" O.0 VERTICALLY BOTH SIDES CONCRETE FOOTING > Q �mm O z \/ O ° . 1/4" THICK EXPANSION JOINT AT ABUTTING CONCRETE w J i/� W MATERIAL (TYP.) W Q • - \ � � __ , i � / / " � -, , . � MATERIALS VARY -SEE PLANS 0 z W � J 2-PA 1-ERC- - - / 7 - 4° / FINISHED GRADE ' d. FINISHED GRADE FINISHED GRADE J Q LL � ll 6 / ° O ELEVATION LO Q W �' FREE STANDING BRICK PIER co 5 q A' n' CONCRETE FOOTING WITH LIGHT FIXTURE 4 d CLASS V AGGREGATE SUBBASEUj U MATCH AT EXIST. W LK , T P. 4 --CA = / / ° a 1 ° d dd 0' ^ - I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS / / _ 3-RAIL FLAT TOP (#1230) 42" HT, WITH HEAVY DUTY ~1_g POSTS, 6' O.C. BY COURTYARD ALUMINUM FENCE -ABM O TYP. SYSTEMS PREPARED BY ME OR UNDER MY DIRECT _ -_ _ i'v -_ SECTION ET 3SECTIONS OFFENCINGBETWEEN PIERS SPACED E FENCING BETWEEN SUPERVISION AND THAT I AM A DULY LICENSED LANDSCAPE ARCHITECT UNDER 5 - HBS - - - 5 DIA. CONC PAD FOR ART INSTAL ION CAP AND BRICK PIER 23"x23" NATURAL STONE CAP THE LAWS OF THE STATE OF MINNESOTA. 5-CAD - ®-- Patrick J. Sarver �I • DATE 11/25/19 LICENSE NO. 24904 GROUND MOUNTED ART PIECE." COORDINATE W/ INSTALLATIOI bF ISSUE/SUBMITTAL SUMMARY & LIGHTING DATE DESCRIPTION 11/06/19 CITY SUBMITTAL 11/25/19 CITY RESUBMITTAL \ 4 -RBC ` 3 Q, KET PARK PLAZA S A ED & COLORED CONC., ART PIECE SPACE (4) / BENCHES, NATURAL STONE SEAT WALL BLOCKS, DECORATIVE FENCING & STONE PIERS 1 / / U o a 1/4" THICK EXP. JOINT (TYP.) j 1 - EKC DECORA IVE. 4 - COP ING ' 14 - BES 9 d ALUMINUM POST GROUTED IN PLACE - - - T SHOPS REG. - - _ _ _ _ - d 8" CONCRETE POST FOOTING 1 - RBC / LAWN, SEE 5 - B y < �O TYP. CLASS V AGGREGATE SUBBASE LEGEND, TYP. •. / a ORNAMENTAL FENCE AND COLUMN 2 (. (J 1 SSC 4 - AD Q NTS 18" MAINT. STRIP, SEE - - - / MATqH EXISTING ' DETAIL & LEGEND, TYP. :. CON'C. WALK, TYP. DRAWN BY:BN REVIEWED BY: DK PROJECT NUMBER: 15016-02 REVISION SUMMARY DATE DESCRIPTION 3-LSRS J� 1 � / LEGEND / SEE SHEET L1.0 / LANDSCAPE PLAN a 0 f PLAZA ENLARGEMENT o POCKET PARK/PLAZA ENLARGEMENT _ _ Know what's below. L 1 before you dig. 2'-6" 0 5-0"Call 0 11/25/2019 8:41:41 AM © COPYRIGHT CIVIL SITE GROUP INC. 19:81►Ile] VAUlll9Eel ilk 1 WEST RICHFIELD 790 W. 66TH. RICHFIELD, MN ARCHITECTURAL SITE PLAN 11. 25. 2019 089 LS ZONING PROPOSED CHASE PARCEL: CURRENT ZONING-PMR (MU) - MAJOR AMENDMENT TO CHANGE ZONING TO PLANNED MIXED -USE COMMUNITY (UM_C) LOT AREA: 18,740 SO FT (.43 ACRES) GROSS BUILDING AREA: 3,270 SO FT BUILDING SETBACK: FRONT YARD REQUIRED: 10' MIN/20' MAX PROPOSED: 15'-11" INTERIOR SIDE YARD REQUIRED: 5' MIN PROPOSED: 36' CORNER SIDE YARD REQUIRED: 5' MIN PROPOSED: 92'-5" REAR YARD REQUIRED: 5' MIN PROPOSED: 39'-1" LANDSCAPING/PARKING SETBACK: REQUIRED: FRONT: 8' MIN SIDE YARD: 8' MIN REAR YARD: 5' MIN PROPOSED: FRONT:15'-11" SIDE YARD:O (VARIANCE REQUIRED) REAR YARD: 11'-5" MAX BUILDING HEIGHT:35' PROPOSED BUILDING HEIGHT: 21'-6" LOADING ZONE: N/A CAR PARKING COUNT DATA: PARKING:1/250 SF PARKING REQUIRED = 13 (INCL. 1 ACCESSIBLE) PARKING PROVIDED = 12 (INCL. 2 ACCESSIBLE) *SHARED PARKING WITH EXISTING PLAZA DRIVE-THRU VEHICLE STACKING: MINIMUM REQUIRED:4 CARS + 1 TELLER PROPOSED STACKING: 2 CARS (VARIANCE REQUIRED) SEE CIVIL UTILITY PLAN FOR PAVED AREA AND IMPERVIOUS SURFACE AREA CALCULATIONS. IF REQUIRED. N 0 20' 40' W 60 Architect/Designer The Architects Partnership 200 South Michigan Avenue Chicago, IL 60604 t: 312.583.9800 f: 312.583.9890 TAP Project Number: 19074 7CR H. I �A ,.--,S � � ME-11, RICHFIELD 790 W 66th St. RICHFIELD, MN 55423 ARCHITECTURAL ELEVATIONS 11 . 25. 2019 SCALE: 0 5' 10'....... ..15 Architect/Designer The Architects Partnership 200 South Michigan Avenue Chicago, IL 60604 t: 312.583.9800 f: 312.583.9890 TAP Project Number: 19074 N88°27'19"E 157.47N79°35'06"E 43.26N88°27'19"E 162.05N88°27'23"E 53.0715.70Δ=18°22'46"R=48.9447.94Δ=15°15'55"R=179.9235.90Δ=20°59'15"R=98.0018.74Δ=35°46'54 "R=30.00 23 . 1 7 Δ= 2 4 ° 0 8 ' 3 2 " R= 5 5 . 0 0 N15°53'58"E12.84N19 ° 0 0 ' 1 5 " E 5 8 . 0 4 S69°33'07"E8.71N68°47'40"W 54.53S59°49'12 "W 163 .92 S00°21'57"E 75.98108.983.70196 . 3 2 17. 9 0TRACT BS68°47'40"E9.166.67 (Rec.)S07°34'18"E 107.87S89°47'46"E 162.7749.0 7 Δ=8° 3 6 ' 4 9 " R=32 6 . 4 0 S20 ° 2 4 ' 5 4 " W 3 0 7 . 4 2N69°35'06"W5.00S20 ° 2 4 ' 5 4 " W 40. 2 6 S54°57'39 "W8.72S89°30'24"W 87.41S00°29'36"E5.00S89°30'24"W 356.60N14°26'04"W 224.62102.58Δ=9°44'08"R=603.69N58°44'04 "E 442 .10S89°30'26"W 130.70N14°12'03"E 63.13 N75°47'57"W21.97N14°12'03"E20.33 N75°53'48"W26.03N14°22'48"W 74.90N59°12'03"E 524 .41S07°34'16"E 104.28S30°47'57 "E6.58N59°12'03 "E12.00S30°47'57"E28.13S59°12'03"W13.60N75° 4 7 ' 5 7 " W 5.67S59°12'03 "W 306 .85 S14°12'03"W 147.36 N79°59'10"E 137.38N08°07'01"E 55.02 TRACT ATRACT CTRACT AT R A C T ET R A C T CT R A C T AT R A C T DT R A C T AT R A C T B R.T. DOC. NOSURVEYORS CERTIFICATIONI Rory L. Synstelien hereby certify that in accordance with the provisions of Minnesota Statutes508.47, Subd. 4, I have surveyed the following described property situated in the county ofHennepin, State of Minnesota, to wit:Tracts A, B, C, E, F, and G, REGISTERED LAND SURVEY NO. 1635ANDTracts A & B, REGISTERED LAND SURVEY NO. 1864I hereby certify that this REGISTERED LAND SURVEY was prepared by me or under my directsupervision and that I am a duly Licensed Land Surveyor under the laws of the state of Minnesotaand this Registered Land Survey is a correct representation of said parcel of land.Dated this day of , 20Rory L. Synstelien, Land Surveyor, Minnesota License No. 44565RICHFIELD, MINNESOTAI hereby certify that this REGISTERED LAND SURVEY was approved and accepted by theCity Council of Richfield, Minnesota at regular meeting thereof heldthis day of , 20.If applicable, the written comments and recommendations of the Commissioner of Transportationand the County Highway Engineer have been received by the City, or the prescribed 30 day periodhas elapsed without receipt of such comments and recommendations, as provided by MinnesotaStatues Section 505.03, Subd. 2.City Council of Richfield, MinnesotaBy: , By:Mayor ManagerRESIDENT AND REAL ESTATE SERVICES, Hennepin County, MinnesotaI hereby certify that taxes payable in and prior years have been paid for land described onthis REGISTERED LAND SURVEY.Dated this day of , 20.Mark V. Chapin, Hennepin County AuditorBy: , DeputySURVEY DIVISION, Hennepin County, MinnesotaPursuant to Minnesota Statues Section 383B.565 (1969), this REGISTERED LAND SURVEY has beenapproved this day of , 20.Chris F. Mavis, Hennepin County SurveyorBy: REGISTRAR OF TITLES, Hennepin County, MinnesotaI hereby certify that the within REGISTERED LAND SURVEY NO. was filed inthis office this day of , 20 at o'clock M.Martin McCormick, Registrar of TitlesBy: , DeputyREGISTERED LAND SURVEY NO.HENNEPIN COUNTY, MINNESOTAThe bearing basis is the west line of the Goverment Lot 1, Section 27,Township 28, Range 24 which is assumed to bear North 00 degreesBENCHMARK:Top nut of the fire hydrant located on the north side of 66th street307 feet east of the southwest boundary corner.Elevation = 848.75 feet (NGVD 1929 Datum)10 minutes 26 seconds West. 60153001530SCALE IN FEETNSHEET 1 OF 3Garage LevelNo Lower Vertical LimitUpper Vertical Limit = 844.0Elevation View(No Scale) S30°49'25 "E3.33176.65 N00°10'26"W33.00 N00°10'26"W 123.27 96.1549. 0 0 279.52 90.70 105.90 104.20 229.81103.00100.00N30°32'34"W 109.45N38°43'37"E 72.12 N00°10'26"W 279.52N88°27'19"E 157.47N79°35'06"E 43.26N88°27'19"E 162.05N88°27'23"E 53.0715.70Δ=18°22'46"R=48.9447.94Δ=15°15'55"R=179.9235.90Δ=20°59'15"R=98.0018.74Δ=35°46'54 "R=30.00 23 . 1 7 Δ= 2 4 ° 0 8 ' 3 2 " R= 5 5 . 0 0 N15°53'58"E12.84N19 ° 0 0 ' 1 5 " E 5 8 . 0 4 S69°33'07"E8.71N68°47'40"W 54.53S59°49'12 "W 163 .92 S00°21'57"E 75.98 46. 7 2108.983.70196 . 3 2 17. 9 0TRACT BS68°47'40"E9.1646. 7 2 6.67 (Rec.)S07°34'18"E 107.87S89°47'46"E 162.7749.0 7 Δ=8° 3 6 ' 4 9 " R=32 6 . 4 0 S20 ° 2 4 ' 5 4 " W 3 0 7 . 4 2N69°35'06"W5.00S20 ° 2 4 ' 5 4 " W 40. 2 6 S54°57'39 "W8.72S89°30'24"W 87.41S00°29'36"E5.00S89°30'24"W 356.60N14°26'04"W 224.62102.58Δ=9°44'08"R=603.69N58°44'04 "E 442 .10TRACT AN59°12'09"E 350.01S30°49'25"E37.36S59°10'35 "W 206 .19S30°44'10"E6.89S14°15'50"W4.36N75°44'10"W14.82 S14°15'50"W2.75S59°15'50"W 74.77S30°44'10"E38.29S75°44'10"E35.08S14°15'50"W12.82S75°44'10"E11.78S14°15'50"W18.55N75°44'10"W4.61S14°15'50"W14.65S75°44'10"E23.71S14°15'50"W 49.33N75°44'10"W11.52S14°15'50"W16.24N76°06'16"W18.62S59°33'56"W13.05N75°50'00"W 35.35N14°12'33"E 53.02 N75°25'17"W21.90N14°06'23"E19.81 N75°53'48"W26.23N14°23'57"W 73.67TRACT DTRACT AT R A C T ET R A C T CT R A C T AT R A C T DT R A C T AT R A C T B R.T. DOC. NOREGISTERED LAND SURVEY NO.HENNEPIN COUNTY, MINNESOTASHEET 2 OF 3Denotes Hennepin County cast iron monument (Found).Denotes 1/2 inch by 14 inch Iron Pipe set marked with a plastic capLinetype & Symbol Legend inscribed "RLS 44565".The bearing basis is the west line of the Goverment Lot 1, Section 27,Township 28, Range 24 which is assumed to bear North 00 degreesBENCHMARK:Denotes JLM set Pursuant to Torrens Case No. 10017 (None Found)Top nut of the fire hydrant located on the north side of 66th street307 feet east of the southwest boundary corner.Elevation = 848.75 feet (NGVD 1929 Datum)10 minutes 26 seconds West. Denotes site benchmark60153001530SCALE IN FEETNStreet Level Lower Vertical Limit = 844.0Upper Vertical Limit = 860.34Elevation View(No Scale) N88°27'19"E 157.47N79°35'06"E 43.26N88°27'19"E 162.05N88°27'23"E 53.0715.70Δ=18°22'46"R=48.9447.94Δ=15°15'55"R=179.9235.90Δ=20°59'15"R=98.0018.74Δ=35°46'54 "R=30.00 23 . 1 7 Δ= 2 4 ° 0 8 ' 3 2 " R= 5 5 . 0 0 N15°53'58"E12.84N19 ° 0 0 ' 1 5 " E 5 8 . 0 4 S69°33'07"E8.71N68°47'40"W 54.53S59°49'12 "W 163 .92 S00°21'57"E 75.98108.983.70196 . 3 2 17. 9 0TRACT BS68°47'40"E9.166.67 (Rec.)S07°34'18"E 107.87S89°47'46"E 162.7749.0 7 Δ=8° 3 6 ' 4 9 " R=32 6 . 4 0 S20 ° 2 4 ' 5 4 " W 3 0 7 . 4 2N69°35'06"W5.00S20 ° 2 4 ' 5 4 " W 40. 2 6 S54°57'39 "W8.72S89°30'24"W 87.41S00°29'36"E5.00S89°30'24"W 356.60N14°26'04"W 224.62102.58Δ=9°44'08"R=603.69N58°44'04 "E 442 .10TRACT ATRACT AN64°43'15"E 149.18N65°03'40"E 142 .41TRACT EN75°47'56"W 133.48N14°12'04"E 118.92 N30°47'56"W 43.53N59°06'53"E 285.12S30°47'56"E 81.41S59°12'04 "W 190 .61 S14°12'04"W 62.92S75°47'56"E 40.17S14°12'04"W 96.35 T R A C T ET R A C T CT R A C T AT R A C T DT R A C T AT R A C T B R.T. DOC. NOREGISTERED LAND SURVEY NO.HENNEPIN COUNTY, MINNESOTASHEET 3 OF 3Denotes Hennepin County cast iron monument (Found).Denotes 1/2 inch by 14 inch Iron Pipe set marked with a plastic capLinetype & Symbol Legend inscribed "RLS 44565".The bearing basis is the west line of the Goverment Lot 1, Section 27,Township 28, Range 24 which is assumed to bear North 00 degreesBENCHMARK:Denotes JLM set Pursuant to Torrens Case No. 10017 (None Found)Top nut of the fire hydrant located on the north side of 66th street307 feet east of the southwest boundary corner.Elevation = 848.75 feet (NGVD 1929 Datum)10 minutes 26 seconds West. Denotes site benchmark60153001530SCALE IN FEETNHigh Rise Level Lower Vertical Limit = 860.34No Upper Vertical LimitElevation View(No Scale) CEMENT PANEL WOODGRAIN COLOR:ASH T.O. 'b' HIGH ROOF +21 T O. MDROOF 10W THIN STONE VENEER FINISH: ROUGH COLOR: LIMESTONE 010 MAIN CPNOPY T.0 LOWGANOPY n, ACM CANOPY COLOR: ANODIZED ALUM. ro sue - a9 THIN STO"Ir TTrKlrrn FIN COLOR: RICHFIELD 790 W 66th St. RICHFIELD, MN 55423 CEMENT PANEL WOODGRAIN COLOR:BARK CEMENT PANEL WOODGRAIN COLOR:ASH 0 WEST ELEVATION ❑❑ SOUTH ELEVATION ARCHITECTURAL ELEVATIONS 11. 25. 2019 ACM CANOPY COLOR: ANODIZED ALUM. DECORATIVE METAL RAILING (BEYOND) THIN STONE VENEER COMPOSITE VENEER PANEL: "BARK" COMPOSITE VENEER PANEL: "ASH" T 0. HIGH PARAPET +21'6 T 0. MID PARMET /j♦ T 0. LOW PARAPET • 16'-0' T0. HIGH WINDOW R0. .1_ 12 ACCENT PARAPET .12-10• B 0. CANOPY d /` T O WINDOW RO /` T O lOW CANOPY T 0. RAILING .q:2' O. RETAINING WALL .2 9' PDRLIC SIDEWALK .ig TO RAMP ,5 '-21IY O.I 0 KAD SCALE: 4' = 1' 0 ... 5 .. ...10 15 Architect/Designer The Architects Partnership 200 South Michigan Avenue Chicago, IL 60604 t: 312.583.9800 f: 312.583.9890 TAP Project Number: 19074 ACM PANEL TG. RIGRRGGF COLOR: ANODIZED ALUM. .21'8 9<OROOF ACM CANOPY COLOR: ANODIZED ALUM. T1 LOTROOF mL T0..0 ROOF .12 T 0. WINO RO .1P8' T O LOW CAWOPY . P-r DECORATIVE METAL RAILING TO SING CEMENT PANEL WOODGRAIN COLOR:BARK ACM PANEL — COLOR: ANODIZED ALUM. SUN SHADE COLOR: ANODIZED ALUM. DECORATIVE METAL RAILING --\ RICHFIELD 790 W 66th St. RICHFIELD, MN 55423 THIN STONE VENEER FINISH: ROUGH COLOR: LIMESTONE CEMENT PANEL WOODGRAIN EAST ELEVATION NORTH ELEVATION ARCHITECTURAL ELEVATIONS 11. 25. 2019 CEMENT PANEL WOODGRAIN COLOR:ASH CEMENT PANEL WOODGRAIN COLOR:BARK ACM CANOPY COLOR: ANODIZED ALUM. SUN SHADE COLOR: ANODIZED ALUM. THIN STONE VENEER COMPOSITE VENEER PANEL: "BARK" COMPOSITE VENEER PANEL: "ASH" THIN STONE VENEER SCALE: a' = 1' 0 5' 10' Architect/Designer The Architects Partnership 200 South Michigan Avenue Chicago, IL 60604 t: 312.583.9800 f: 312.583.9890 TAP Project Number: 19074 DECORATIVE METAL RAILING (BEYOND) TO.MGRROOF .21'L' TO. MIO ROOF 1P-0• 10.NIGNMN"RO .19T. T O. WIN CANOPY TO. SLAB P-P ACM CANOPY COLOR: CHASE BLUE 6X6 HSS COLLIN COLOR: CLEAR ANODI2 ALI SOUTH ELEVATION DRIVE-THRU ACM CAN01 COLOR: CHASE BL 6X6 HSS COLUMNS COLOR: CLEAR ANODIZED ALUM. (::H-lA91E0 RICHFIELD 790 W 66th St. RICHFIELD, MN 55423 N..F.A..NNI�PY 'ED ACM CANOPY JM. COLOR: CHASE BLUE TO. ROOF B.O. CANOPY ,V-0• 6X6 HSS COLUMNS COLOR: CLEAR ANODIZED ALUM. TO. CURB IB D ACM CANOPY :AR ANODIZED ALUM. O RODF B O_ CANOP 57 T0. CURB -ND NORTH ELEVATION DRIVE-THRU ACM CANOPY COLOR: CLEAR ANODIZED ALUM. T O. ROOF B 0 . CPNOPY 207 I (� 2-�r- �� TO. CURB ISUJiO a-B•. uL I ,ul WEST ELEVATION DRIVE-THRU ARCHITECTURAL ELEVATIONS 11 . 25. 2019 ACM CANOPY COLOR: CHASE BLUE 6X6 HSS COLUMNS COLOR: CLEAR ANODIZED ALUM. EAST ELEVATION DRIVE-THRU SCALE:" = 1' ......... . 0 5' 10' 15' Architect/Designer The Architects Partnership 200 South Michigan Avenue Chicago, IL 60604 t: 312.583.9800 f: 312.583.9890 TAP Project Number: 19074 ACM CANOPY .AR ANODIZED ALUM.. OF h NOPY� RB ISI D AGENDA SECTION:RESOLUTIONS AGENDA ITEM #5. STAFF RE P ORT NO. 23 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Jennifer A nderson, S upport S ervices Manager D E PA RTME NT D IRE C TO R RE V IE W: Jay Henthorne, P ublic S afety D irector/C hief of P olice 1/21/2020 O THE R D E PA RTM E NT RE V IE W: C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the approval of a resolution authorizing the lawful gambling premises permit for Minneapolis- Richfield American Legion Post #435, 6501 Portland Avenue South. E X E C UT IV E S UM M ARY: On November 19, 2019, the City received an application for a premises permit to be submitted to the Minnesota State Gambling Control Board by Minneapolis-Richfield American Legion Post #435, 6501 Portland Avenue South. The American Legion Auxiliary Unit currently holds a premises permit at the Minneapolis-Richfield American Legion Post #435 because of the American Legion having their gambling license revoked in 2014. The American Legion can now apply with the state for a gambling premises permit. The Public Safety Director has reviewed the background information and documents and approves of its contents and sees no basis for denial. RE C O M M E ND E D AC T I O N: By motion: Adopt the resolution approving the lawful gambling premises permit application from the Minneapolis-Richfield American Legion Post #435, 6501 Portland Avenue South. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T On November 19, 2019, the City received all the required documents from the Minneapolis-Richfield American Legion Post #435, 6501 Portland Avenue South, to conduct lawful gambling. A Public Safety background investigation was completed. The Public Safety Director has reviewed the information in the background investigation report. There is no information in the investigation that shows any cause for recommending denial of the requested license. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): Richfield City Code 1100.13 requires the Public Safety Department to review the request for the gambling license and make its review and recommendation to the City Council. C.C R IT IC AL T IMIN G IS S U E S: The Minnesota Gambling Control Board approves permit applications at the beginning of each month. I f the Council adopts the Resolution at the meeting on J anuary 28, 2020, the Minneapolis-Richfield American Legion Post #435 could potentially begin operation and management of the gambling activity at the Legion after February 1, 2020. Otherwise, the applicant would be required to wait until March 1, 2020. D.F IN AN C IAL IMPAC T: There is no financial impact. E.L E GAL C ON S ID E R AT ION: There are no legal considerations. ALTE R N AT IV E R E C O MME N D ATIO N(S): The City Council could deny the request for the premises permit for the Minneapolis-Richfield American Legion Post #435. This would mean the applicant would not be able to conduct gambling activities at the Minneapolis-Richfield American Legion Post #435. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: Parties from the Minneapolis-Richfield American Legion Post #435 have been notified of the meeting and will have a representative present. AT TAC H ME N T S: D escription Type A merican L egion Resolution C over Memo RESOLUTION NO. ____ A RESOLUTION APPROVING THE LAWFUL GAMBLING PREMISES PERMIT APPLICATION FOR THE MINNEAPOLIS-RICHFIELD AMERICAN LEGION POST #435 TO CONDUCT LAWFUL GAMBLING AT THE MINNEAPOLIS-RICHFIELD AMERICAN LEGION POST #435 AT 6501 PORTLAND AVENUE SOUTH WHEREAS, the Minneapolis-Richfield American Legion Post #435 is submitting an application to the Minnesota Gambling Control Board for approval of a Premises Permit application to conduct lawful charitable gambling at the Minneapolis-Richfield American Legion Post #435 at 6501 Portland Avenue South, Richfield, MN; and WHEREAS, the gambling premises is located within the City limits of Richfield, Minnesota; and WHEREAS, the Minneapolis-Richfield American Legion Post #435 will be responsible for operating and managing the lawful gambling activity at the American Legion site and will comply with all applicable requirements of city code and state statutes. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Richfield, Minnesota that the City Council does hereby approve the issuance of a Premises Permit to the Minneapolis-Richfield American Legion Post #435 to conduct lawful charitable gambling activities at the Minneapolis-Richfield American Legion Post #435, 6501 Portland Avenue South, Richfield, Minnesota. Adopted by the City Council of the City of Richfield, Minnesota this 28th day of January 2020. Maria Regan Gonzalez, Mayor ATTEST: Elizabeth VanHoose, City Clerk AGENDA SECTION:RESOLUTIONS AGENDA ITEM #6. STAFF RE P ORT NO. 24 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: B lanca Martinez Gavina D E PA RTME NT D IRE C TO R RE V IE W: O THE R D E PA RTM E NT RE V IE W: E xecutive D epartment C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider a resolution to support the coordinated census efforts and funding to ensure that all Richfield residents are counted in the 2020 Census. E X E C UT IV E S UM M ARY: The City of Richfield is leading census efforts with the Richfield Counts 2020 Census Campaign. The resolution will make sure that: 1 . The City of Ric hfield seeks the financial support in the amount of $ 21,900 from Hennepin County to ensure that all residents are counted in the 2020 Census, especially ‘hard to count’ communities. 2 . The C ity of Richfield seeks support from our county, state and federal representatives to coordinate outreach and mobilize communities. 3 . The City of Ric hfield seeks to serve as coordinating entity that will support the efforts of the U.S. Census Bureau to ensure a complete and accurate reporting. RE C O M M E ND E D AC T I O N: By motion: Adopt a resolution to support the Richfield Counts Census 2020 Campaign. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T The U.S. Census Bureau is required by the U.S. Constitution to conduct a count of the population to help shape the foundation of our society and play an active role in American democracy. The City of Richfield is leading efforts by coordinating outreach, communication and community education for residents, staff and City leadership. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): C.C R IT IC AL T IMIN G IS S U E S: The Census officially begins in March and ends approximately in J uly. There is a critical need for funding to begin the mobilization and counting of residents. D.F IN AN C IAL IMPAC T: The City of Richfield is seeking financial support from Hennepin County to offset Census costs. E.L E GAL C ON S ID E R AT ION: ALTE R N AT IV E R E C O MME N D ATIO N(S): Do not approve a resolution supporting the efforts of the Richfield Counts 2020 Census Campaign. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: AT TAC H ME N T S: D escription Type Resolution of 2020 C ensus Resolution L etter RESOLUTION NO. 11710 RESOLUTION SUPPORTING THE RICHFIELD COUNTS 2020 CENSUS EFFORTS WHEREAS, the U.S. Census Bureau is required by the U.S. Constitution to conduct a count of the population to help shape the foundation of our society and play an active role in American democracy; and WHEREAS, the demographics of the City of Richfield continue to grow and shift, including individuals who are from ‘hard to count’ communities and identify as multiracial, ethnic minority, highly mobile, person with disabilities; and WHEREAS, the City of Richfield is committed to ensuring that every resident is counted in the 2020 decennial census and avoiding the undercount of the estimated 7,323 residents who could be missed; and WHEREAS, billions of dollars per year in federal and state funding are allocated to communities, and decisions are made on matters of national and local importance based on census data, including; healthcare, community development, housing, education, transportation, social services, employment and much more; and WHEREAS, census data determines how many seats each state will have and our State is at risk at losing the a Congressional District which represents Minnesota in the U.S. House of Representatives as well as the redistricting of state, county and city, and voting districts; NOW, THEREFORE, I, MARIA REGAN GONZALEZ, Mayor of the City of Richfield, on behalf of the Richfield City Council, let it be resolved that: 1. The City of Richfield seeks the financial support in the amount of $ 21,900 from Hennepin County to ensure that all residents are counted in the 2020 Census, especially ‘hard to count’ communities. 2. The City of Richfield seeks support from our county, state and federal representatives to coordinate outreach and mobilize communities. 3. The City of Richfield seeks to serve as coordinating entity that will support the efforts of the U.S. Census Bureau to ensure a complete and accurate reporting. Adopted by the City Council of the City of Richfield, Minnesota this 28th day of January 2020. _______________________________ Maria Regan Gonzalez, Mayor ATTEST: ______________________________ Elizabeth VanHoose, City ClerK AGENDA SECTION:RESOLUTIONS AGENDA ITEM #7. STAFF RE P ORT NO. 25 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: Jennifer A nderson, S upport S ervices Manager D E PA RTME NT D IRE C TO R RE V IE W: Jay Henthorne, P ublic S afety D irector/C hief of P olice 1/21/2020 O THE R D E PA RTM E NT RE V IE W: NA C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Violation hearing and consideration of a resolution regarding civil enforcement for establishments that recently underwent alcohol compliance checks conducted by Richfield Public Safety staff, and failed by selling alcohol to underage youth. E X E C UT IV E S UM M ARY: Richfield Public Safety staff conducted phase two of the alcohol compliance checks for 2019. These checks are done to determine the availability of alcohol to underage youth and to meet State Statutes. There are currently 36 establishments that hold licenses to sell alcohol in Richfield. Compliance checks were conducted at all 36 establishments. Three of the 36 establishments sold alcohol to an underage youth. The action being taken today is for civil enforcement and penalties against those establishments: 1) V P C Richfield Pizza, LLC. d/b/a Giordano's of Richfield located at 3000 66th Street W est. 2) El Tejaban Mexican Restaurant, L L C. d/b/a El Tejaban Mexican Grill located at 6519 Nicollet Avenue South. 3) J imenez Genao, L L C. d/b/a La Vaquita 2 located at 607 77th Street East. T his is a first alcohol compliance check failure for VP C Richfield Pizza, L LC. d/b/a Giordano's of Richfield located at 3000 66th Street West. T hey have no previous failures. T his is the first alcohol compliance check failure for El Tejaban Mexican Restaurant, L LC. d/b/a El Tejaban Mexican Grill located at 6519 Nicollet Avenue South. T hey have no previous failures. T his is the first alcohol compliance check failure for Jimenez Genao, LL C. d/b/a La Vaquita 2 located at 607 77th Street East. T hey have no previous failures. T he establishments will be given an opportunity to either admit they made an unlawful sale to a minor and agree to the penalties imposed by the City Council, or deny the allegations and request a contested case hearing. I f they admit to the violation, the Council will adopt a resolution imposing the penalties. I f they deny the allegation and request a contested case hearing, the City Council will refer the matter to an independent hearing examiner. They will be notified of the date of the hearing and will be provided the opportunity to present evidence and to rebut the City’s evidence. For first time violators, Public Safety recommends the City Council follow the guidelines set forth in Resolution No. 9511. Suspend the license to sell alcohol for five days and pay a $1,000 fine. Require a meeting with the Public Safety Director to present a written action plan to ensure elimination of future failures. Require a manager to attend an alcohol compliance and sales awareness training conducted by a private firm, approved by Public Safety, with all costs to be paid by the establishment. RE C O M M E ND E D AC T I O N: By motion: Approve the attached resolutions regarding civil enforcement for V P C Richfield Pizza, LL C. d/b/a Giordano's of Richfield located at 3000 66th Street West, El Tejaban Mexican Restaurant, LL C. d/b/a El Tejaban Mexican Grill located at 6519 Nicollet Avenue South, and Jimenez Genao, L LC. d/b/a La Vaquita 2 located at 607 77th Street East. These establishments failed alcohol compliance checks by selling alcohol to an underage youth. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T On December 19, 2019 Richfield Public Safety staff conducted alcohol compliance checks at 36 establishments in Richfield that sell alcohol. The compliance checks were the second round of checks conducted in 2019. Public Safety staff was assisted by two underage youth who are eighteen years old. The establishments that sold alcohol to underage youth are: V P C Richfield Pizza, LLC. d/b/a Giordano's of Richfield located at 3000 66th Street W est. El Tejaban Mexican Restaurant, LLC. d/b/a El Tejaban Mexican Grill located at 6519 Nicollet Avenue South. J imenez Genao, LLC. d/b/a La Vaquita 2 located at 607 77th Street East. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): I t is a violation of Minnesota State Statute and City ordinance to sell alcohol to underage youth. Resolution 9511 specifies certain improper conduct of alcohol license holders and delineates the progressive discipline that can be expected when violations occur, such as the sale of alcohol to minors. C.C R IT IC AL T IMIN G IS S U E S: Fine and suspension requirements must be met by February 28, 2020. D.F IN AN C IAL IMPAC T: The fine being recommended at this time is intended to recover 100% of the costs for conducting the compliance checks and to impose a financial penalty. E.L E GAL C ON S ID E R AT ION: Formal complaint charges for the selling of alcohol to an underage person have been filed against the clerks who made the sale at each establishment. ALTE R N AT IV E R E C O MME N D ATIO N(S): The Council may consider taking more or less severe action against the establishments that sold alcohol to an underage youth; however, that would deviate from the guidelines set for progressive discipline in Resolution 9511. P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: A representative from V P C Richfield Pizza, L L C. d/b/a Giordano's of Richfield located at 3000 66th Street W est, El Tejaban Mexican Restaurant, LLC. d/b/a El Tejaban Mexican Grill located at 6519 Nicollet Avenue South, and J imenez Genao, L L C. d/b/a La Vaquita 2 located at 607 77th Street East. They have been notified in writing of this requirement. AT TAC H ME N T S: D escription Type E l Tejaban Mexican Restaurant Resolution Resolution L etter L a Vaquita 2 Resolution Resolution L etter Giordano's of Richfield Resolution Resolution L etter RESOLUTION NO. RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR EL TEJABAN MEXICAN RESTAURANT, LLC. d/b/a EL TEJABAN MEXICAN GRILL, 6519 NICOLLET AVENUE SOUTH, AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE WHEREAS, El Tejaban Mexican Restaurant, LLC. d/b/a El Tejaban Mexican Grill (“Licensee”) holds On Sale Intoxicating and Sunday Liquor licenses from the City of Richfield; and WHEREAS, on December 19, 2019 the City of Richfield Public Safety Department conducted a compliance check of the Licensee’s establishment and during the compliance check, an employee of the Licensee, sold alcohol to a minor; and WHEREAS, this is the first alcohol compliance check failure at this establishment; and WHEREAS, the Licensee appeared before the Richfield City Council on January 28, 2020 and admitted the violation and stipulated to the penalty imposed by this resolution. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Richfield as follows: The Licensee’s On Sale Intoxicating and Sunday Liquor Licenses are hereby suspended for a period of five (5) consecutive days, commencing on a date to be determined by the Public Safety Director, but to take place within 30 days after their Council appearance. 1. A civil penalty of $1,000 is hereby imposed. On or before February 28, 2020, the Licensee shall deliver a check or money order payable to the City of Richfield in the amount of $1,000. 2. Meet with the Director of Public Safety by February 28, 2020 to present a written action plan to ensure future compliance. 3. One staff member, preferably the manager, must attend an alcohol compliance and sales awareness training conducted by a private firm, approved by Public Safety, with all costs to be paid by the establishment. Passed by the City Council of the City of Richfield this 28th day of January 2020. _________________________ Maria Regan Gonzalez, Mayor ATTEST: ________________________ Elizabeth VanHoose, City Clerk RESOLUTION NO. RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR JIMENEZ GENAO, LLC. d/b/a LA VAQUITA 2, 607 77TH STREET EAST, AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE WHEREAS, Jimenez Genao, LLC. d/b/a La Vaquita 2 (“Licensee”) holds an Off Sale 3.2 Percent Malt Liquor License from the City of Richfield; and WHEREAS, on December 19, 2019 the City of Richfield Public Safety Department conducted a compliance check of the Licensee’s establishment and during the compliance check, an employee of the Licensee, sold alcohol to a minor; and WHEREAS, this is the first alcohol compliance check failure at this establishment; and WHEREAS, the Licensee appeared before the Richfield City Council on January 28, 2020 and admitted the violation and stipulated to the penalty imposed by this resolution. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Richfield as follows: The Licensee’s Off Sale 3.2 Percent Malt Liquor License is hereby suspended for a period of five (5) consecutive days, commencing on a date to be determined by the Public Safety Director, but to take place within 30 days after their Council appearance. 1. A civil penalty of $1,000 is hereby imposed. On or before February 28, 2020, the Licensee shall deliver a check or money order payable to the City of Richfield in the amount of $1,000. 2. Meet with the Director of Public Safety by February 28, 2020 to present a written action plan to ensure future compliance. 3. One staff member, preferably the manager, must attend an alcohol compliance and sales awareness training conducted by a private firm, approved by Public Safety, with all costs to be paid by the establishment. Passed by the City Council of the City of Richfield this 28th day of January 2020. _________________________ Maria Regan Gonzalez, Mayor ATTEST: ________________________ Elizabeth VanHoose, City Clerk RESOLUTION NO. RESOLUTION SUSPENDING THE LIQUOR LICENSE FOR VPC RICHFIELD PIZZA, LLC. d/b/a GIORDANO’S OF RICHFIELD, 3000 66th STREET WEST, AND IMPOSING A CIVIL PENALTY FOR FIRST TIME ALCOHOL COMPLIANCE FAILURE WHEREAS, VPC Richfield Pizza, LLC d/b/a Giordano’s of Richfield (“Licensee”) holds On Sale Intoxicating and Sunday Liquor licenses from the City of Richfield; and WHEREAS, on December 19, 2019 the City of Richfield Public Safety Department conducted a compliance check of the Licensee’s establishment and during the compliance check, an employee of the Licensee, sold alcohol to a minor; and WHEREAS, this is the first alcohol compliance check failure at this establishment; and WHEREAS, the Licensee appeared before the Richfield City Council on January 28, 2020 and admitted the violation and stipulated to the penalty imposed by this resolution. NOW, THEREFORE, BE IT RESOLVED by the City Council of the City of Richfield as follows: The Licensee’s On Sale Intoxicating and Sunday Liquor Licenses are hereby suspended for a period of five (5) consecutive days, commencing on a date to be determined by the Public Safety Director, but to take place within 30 days after their Council appearance. 1. A civil penalty of $1,000 is hereby imposed. On or before February 28, 2020, the Licensee shall deliver a check or money order payable to the City of Richfield in the amount of $1,000. 2. Meet with the Director of Public Safety by February 28, 2020 to present a written action plan to ensure future compliance. 3. One staff member, preferably the manager, must attend an alcohol compliance and sales awareness training conducted by a private firm, approved by Public Safety, with all costs to be paid by the establishment. Passed by the City Council of the City of Richfield this 28th day of January 2020. _________________________ Maria Regan Gonzalez, Mayor ATTEST: ________________________ Elizabeth VanHoose, City Clerk AGENDA SECTION:OTHER BUSINESS AGENDA ITEM #8. STAFF RE P ORT NO. 26 CIT Y COUNCIL ME E T ING 1/28/2020 RE P O RT P RE PA RE D B Y: B lanca Martinez Gavina D E PA RTME NT D IRE C TO R RE V IE W: K atie Rodriguez 1/22/2020 O THE R D E PA RTM E NT RE V IE W: C ITY MA NA G E R RE V IE W: K atie Rodriguez 1/22/2020 I T E M F O R C O UNC IL C O NS ID E RAT I O N: Consider the appointments to City advisory commissions. E X E C UT IV E S UM M ARY: Terms of several City advisory commission members expire on J anuary 31, 2020. I n addition, due to resignations there are mid-term vacancies that should be filled. Terms for advisory commissions are for three years. Please refer to the attached list of appointments for reference. The City Council directs the City Manager ’s office to conduct an annual recruitment seeking applicants to fill the vacancies. This recruitment includes a press release and information on the City’s website and social media platforms. Applicants were interviewed at a work session held on J anuary 11 and J anuary 16 of 2020. To ensure a quorum at future advisory commission meetings, the City Council should make advisory commission appointments at the J anuary 28, 2020, City Council meeting. RE C O M M E ND E D AC T I O N: By motion: Appoint members to fill the expiring or vacant terms on City advisory commissions referenced in the attached list. B AS IS O F RE C O M M E ND AT I O N: A.H IS TOR IC AL C ON T E X T This information is contained in the Executive Summary. B.P OL IC IE S (resolutions, ordinances, regulations, statutes, etc): City advisory commissions were established by City ordinance or resolution. C.C R IT IC AL T IMIN G IS S U E S: Several terms of City advisory commission members expire on J anuary 31, 2020. To ensure a quorum at future advisory commission meetings, the City Council should make appointments at the J anuary 28, 2020, City Council meeting. D.F IN AN C IAL IMPAC T: None E.L E GAL C ON S ID E R AT ION: None ALTE R N AT IV E R E C O MME N D ATIO N(S): None P R IN C IPAL PAR TIE S E X P E C TE D AT ME E TIN G: AT TAC H ME N T S: D escription Type 2020 C ommission/B oard A ppointments B ackup Material ADULT COMMISSION VACANCIES Term Expires ADVISORY BOARD OF HEALTH Raye Black January 31, 2023 Sara Lundberg January 31, 2023 Katrina DeVore January 31, 2023 ARTS COMMISSION Janie Mork January 31, 2023 Mia Simpson January 31, 2023 Brittany Trushin January 31, 2022 CIVIL SERVICE COMMISSION Mary Stratton January 31, 2023 Mid-term vacancy Jackie Harris January 31, 2021 COMMUNITY SERVICES COMMISSION David Benson January 31, 2023 Mejbah Ahmed January 31, 2023 Stephanie Nwaudo January 31, 2023 Mid-term vacancy Heather MacDonald January 31, 2021 FRIENDSHIP CITY COMMISSION Cecilia Wright January 31, 2023 James Schauer January 31, 2023 HUMAN RIGHTS COMMISSION Mara Glubka January 31, 2023 Fountia Thompson-Robinson January 31, 2023 PLANNING COMMISSION Allysen Hoberg January 31, 2023 Bryan Pynn January 31, 2023 TRANSPORTATION COMMISSION Dan Edgerton January 31, 2023 Kyle Schmidt January 31, 2023 Mollie O’Howard January 31, 2023 Mid-term vacancy Louis Dzierzak January 31, 2022 Term Expires SUSTAINABILITY COMMISSION Jeremy Barthels January 31, 2023 Amanda Kueper January 31, 2023 Laura Durenberger-Grunow January 31, 2023 Brian Shaw January 31, 2022 Kameron Murray January 31, 2022 Alyssa Sanden January 31, 2022 Carolyn Engeldinger January 31, 2022